Streamer Profile Picture

KaiCenat

⚔️100+ HOUR STREAM⚔️ELDEN RING DLC MARATHON⚔️CLICK HERE⚔️LORD DWARF⚔️ELITE GAMER⚔️FOCUS⚔️

06-23-2024 · 47h 54m

⚠️ VOD is unavailable.

kaicenat VODs on twitch

Broadcasts 30+ hours are truncated. View the Raw Transcript VTT for the full version.


[00:00:00] Yo chat, yo chat, yo chat.
[00:00:07] Refresh!
[00:00:09] Refresh!
[00:00:12] Refresh!
[00:00:15] Refresh! Refresh!
[00:00:23] Refresh!
[00:00:27] Hold on.
[00:00:31] Refresh
[00:00:46] Refresh
[00:00:52] Refresh refresh
[00:00:56] Hold on refresh Refresh.
[00:00:59] Yo chat, yo chat, yo chat Yo chat, everybody say
[00:01:01] Yeeeah
[00:01:02] Everybody say yeeeeeeerrrr! Everybody say yeah
[00:01:20] I bet that's good right there
[00:01:27] Okay back
[00:01:27] Yo chat what's going on ya boys?
[00:01:35] Yo, I don't have a kid
[00:01:37] I be gon' hook you up
[00:01:38] I'm gonna hook you man You gon' go hook me up Make it good work again CUT YO WHAT'S GOING ON Y'ALL I put my name, bitch a color man I put my poppa little picture on another
[00:01:51] Yo what's going on y'all?
[00:01:53] What the fuck is up jet?
[00:01:55] I don't use niggas from anywhere
[00:01:57] I don't let Christian be all in my underwear
[00:01:59] Proud of me and it cost me 100 pairs Don't want no other armor that's from city here be
[00:02:01] looking at me like i'm kind of weird niggas be thinking they running my city where 4 4
[00:02:12] 4
[00:02:14] 4
[00:02:16] 4
[00:02:18] 4
[00:02:20] 4 4 other hands
[00:02:30] shout out to everybody who's in the stream right now!
[00:02:33] Shoutout to everybody who's in the stream, yo what's going on?
[00:02:37] We're at the end.
[00:02:40] We're closing in on the DLC!
[00:02:46] We are closing in on the DLC!
[00:02:52] We're closing in on the DLC, what's going on chat?
[00:02:58] What the fuck going on my niggas
[00:03:02] What's going on Samox, yo the Ninja Gauntlet is for the sub Rawmar what's going on Samox? Yo the Ninja got to take a look at this for the sub.
[00:03:05] Rawmore what's going on bro?
[00:03:07] You Baker was good my nigga, Carmelo was good my nigga,
[00:03:10] Brayden was good my nigga, Sonny was good my nigga!
[00:03:20] Rodriguez, Rod- was good my Rodriguez Rod Rodriguez with the it was good my Wacky was good my secluded was good my jiggy was good my nigga
[00:03:31] what's good my niggas all right we got wait study we thought if
[00:03:35] you had this is it the last sound We got wait funny. We thought it was
[00:03:38] Is it the last? Cyboss kids that was good. Isn't it the last time boss?
[00:03:46] No, but the sample time we were just there!
[00:04:00] You can do the final after this, yeah? Okay.
[00:04:01] I need her!.
[00:04:15] What's really wrong with my knee, bro?
[00:04:20] Yo champ! What is really wrong with my knee, bro?
[00:04:26] Like all just aside
[00:04:28] like what the fuck is wrong with my knee?. Wait, wait, wait! Hold on.
[00:04:51] People are telling me I just spoiled the last boss!
[00:04:54] Oh, okay.
[00:04:55] So you're saying that I'm supposed to spoil the last boss?
[00:04:58] Yeah.
[00:04:59] You know what?
[00:05:00] I don't care about it.
[00:05:01] I'm going to spoiled the last boss!
[00:05:07] So I was in a-I was on a stream
[00:05:11] with over 100 thousand niggas and nobody told me yo chill game
[00:05:19] I said this person just posted this right here bro I should just fucking post it this money
[00:05:33] that's alright. Alright, man! Um...
[00:05:35] Okay so...
[00:05:37] Okay hold on. Where is some-
[00:05:39] Anybody who missed the streams and shit
[00:05:41] We've been running through side bosses all day
[00:05:43] We were about to do this last side balls and then we're going straight into
[00:05:46] fighting the final balls, okay? Look at my map! Clap it up for the map, clap it up
[00:05:50] for the discovery.
[00:05:54] Clap it up for everything like that you feel what I'm J.J., this is the 5GP. Clap up for map, clap up for everything like that. You feel what I'm saying? W fucking map. I'm feeling like going to fucking explore. Um...
[00:06:01] But where was I at? Hello?
[00:06:11] Very bottom.
[00:06:15] Is it here?!... For sure. For sure, for sure Dex.
[00:06:30] For sure.
[00:06:34] Everybody spam lock in! Lock In!
[00:06:36] Everybody spam lock in! Lock In! Everybody spam lock in, man.
[00:06:43] Everybody spam lock in. I'm going to have to do this again. Hey! so so I'm not sure if you can see the so Damn!
[00:07:58] What the fuck?
[00:08:04] Oh shit.
[00:08:06] Okay, lock in. Wait hold on wait I ain't alive
[00:08:08] This is what you gotta do okay? You have to
[00:08:10] just be patient
[00:08:12] You got to just be patient. You gotta just be patient!
[00:08:19] Okay, one thing that I noticed
[00:08:21] was when you hear the
[00:08:23] horse and he goes That means what i'll attack you so
[00:08:28] as long as we know that.
[00:11:08] Why do we have to jump through this whole shit? Oh shit, he doesn't get off the horse in the first time I'm not sure if you can see the uh Okay. so so so so so so Okay, now I'm starting on it. I wasn't attacking because I was starting. I wasn't attacking because I was starting.
[00:11:19] I was just trying to see how he does it. Ah shit here we go ya fuck! wait he doesn't bleed
[00:11:35] that's cat i think he does bleed.
[00:11:36] I just haven't gotten to get him yet.
[00:11:43] I think he does need to come.
[00:11:57] Look, Imma try it. I'm gonna try and go for the bleed. Watch'm gonna try to go for the bleed. Watch.
[00:11:59] I'm gonna try to go for the bleed. Watch, watch, watch, watch, watch. Oh! so I'm not sure if that's the right way to do it.
[00:12:26] I think he's going to try and get me out of here. He definitely does!
[00:12:38] I'm not sure if he's going to make it, but I think he will. so so so I want to get my mana.
[00:13:24] Okay, fuck!
[00:13:28] Okay...
[00:13:30] I jump on those?
[00:13:36] Do I jump on those or do I... Oh shit.
[00:13:38] Wait, do I jump on that blue one?
[00:13:41] I feel like I could roll into that last blue
[00:13:44] The one he just threw at me I feel like I can roll into that last loop. The one he just threw at me,
[00:13:45] I feel like I can roll into that.
[00:13:51] Oh shit!
[00:13:52] Anthony Davis texted me and, you straight my G?
[00:13:56] I was at the movies.
[00:14:42] Come on. so W, W, Wba players man wmba players bro Let's go chat. We do have to upgrade that mine i'm not gonna lie bro so so so so so so so I'm not going to let you get away with this. I'll be right back.
[00:16:23] Another line! Another line! Now horse, we got the horseshit down pack.
[00:16:28] You can tell him you can tell him you can tell him you can tell him you can tell him
[00:16:31] you can tell him you can tell him.
[00:16:32] Chat you can tell him bro we have the horse it down pack you feel me
[00:16:37] Kendrick dropped
[00:16:42] mods can be confirmed that confirm that.
[00:17:05] So why? Why did I spin that, bro? so Okay, lock in, lock in. so uh so so so so so so so so so so so I'm not sure if you can see the so I'm not sure if you can see it, but the AHHHHH! AHH!
[00:20:35] Sorry but sorry bro
[00:20:37] I can't, you can't just
[00:20:39] attack. You can't you can't just attack you can't like holy shit
[00:20:45] those who play outer ring y'all understand bro my dodging might be trash as fuck though.
[00:20:52] But those who actually play Outer Ring you understand, man.
[00:20:56] You have to wait for the right moment to attack for you. Yeah, my timing could be better.
[00:21:18] I need to dodge hit bro!
[00:21:22] I don't know how to dodge hit. Dodge dodge here i don't know how to do that Panic Balling! so so so so so I'm not sure if you can see it, but the Fuck!
[00:26:22] Fuck! Shit! so so so so so Oh my gosh, bro. I can't hit this motherfucker. so so so so so so so so so so Oh my gosh! Oh my gosh!
[00:26:25] Oh my god!
[00:26:38] This thing is annoying. Oh my gosh.
[00:26:41] Come on. Come on! come on
[00:29:56] okay go come on KC! so so so oh so so so so so so so so so I'm not sure if you can see the Fuck! I can see what he's doing.
[00:30:00] I know what he is doing.
[00:30:04] I know what he's doing Chad.
[00:30:11] Lock him, lock him, lock him, lock him. I don't know how to roll attack. so Oh my...
[00:30:59] Yo, he is whooping my ass chat
[00:31:13] and well here's the thing with him right
[00:31:17] he's very good at this
[00:31:22] but i'm not gonna be able to do it because of his And, well here's the thing with him right? He is running.
[00:31:25] How do I like get to his side fast without having to use too was supposed about stamina
[00:31:33] oh he's running game so is the tights are slow you gotta go pump fake stone so The so so The so so so so so so so so so so so so so so so so I'm not sure if you can see it, but the It's cool.
[00:36:01] It's fine.
[00:36:03] It's going to work.
[00:36:04] It's cool bro.
[00:36:13] Oh my gosh! Progress.
[00:36:17] Does this one give me facts like the phrase that I need what do you mean no?
[00:36:32] What do you mean no?! You should never have told me that bro!
[00:36:36] You should've never told me that bro
[00:37:05] what do you mean no like what do you mean no okay I'm getting my moons. If this nigga don't give me what I need,
[00:37:07] I might as well
[00:37:11] get to the final boss!
[00:37:13] But I'm gonna complete it, bro.
[00:37:21] ... so I'm not sure if you can see the so so I'm not sure if you can see the so so so I'm not going to do that. Play the kid! Oh my fucking gosh bro, I got a vision for this shit.
[00:39:15] I got a VISION for this shit bro! No, I'm definitely going to fraud him.
[00:39:24] Yes!
[00:39:25] God, I got a whole physical...
[00:39:27] No, I guess I could...
[00:39:28] Ah, shut your fucking dumbass up bitch.
[00:39:31] Shut up nigga.
[00:39:33] You know what? Fuck it.
[00:39:35] You know what?!
[00:39:36] YOU KNOW WHAT?!?!
[00:39:38] You know what?
[00:39:40] We're doing it.
[00:42:24] I'm the king! what we're doing it uh Come on. so so so so Look at him! so so so I'm going to have to do this again. Oh my gosh Come on, boy. Come on, bro!
[00:42:29] I'm gonna get you, boy. Come on, bro!
[00:44:10] Come on! so so so so so so so so I'm not sure if this is the best way to do it, but I'll try.
[00:45:55] Oh, are you you avoid that? so so so so so so oh Oh, fuck! Fuck! W50? Huh?! 50 what?
[00:45:56] 50 what?
[00:45:57] 50 what?
[00:45:58] 50 what?
[00:45:59] 50 what?
[00:46:00] 50 what?
[00:46:01] 50 what?
[00:46:02] 50 what?
[00:46:03] 50 what?
[00:46:04] 50 what?
[00:46:07] 50 what? 50 what?
[00:46:14] Oh! 50 hours! Holy shit.
[00:46:18] Holy fuck.
[00:46:23] AAAAAAAAHHHHH!!!
[00:46:42] The end... so Oh shit.
[00:49:40] W-50 fuckin' 50-50! so so so so so so so so I'm not sure if you can see it, but the him so so so so Kill the cat with a 50 gifted! KILL THE CAT WITH A 50 GIFTED!
[00:49:47] Thank you. That's a 50 gifted. thank you
[00:49:57] oh my gosh can i just like hurry up and tee up on this
[00:50:03] like Like, fuck! I think he bleeds but not that much.
[00:50:04] Actually, I don't know if he bleeds.
[00:50:05] I'm not gonna lie.
[00:50:06] It's like the other bosses you can hear it like.
[00:50:09] I haven't heard...
[00:50:10] I've never been here no
[00:50:21] ghost so what do they hate? What do ghosts hate in this game?
[00:50:30] Holy...
[00:50:35] Holy damage.
[00:50:39] Remind me to do a-
[00:50:42] Remind me after this if i win or lose so I'm not sure if you can see the so so Bro!
[00:51:45] You see bow like what so I'm not sure if this is the best way to do it, but I think you can get a lot of points for that.
[00:52:15] I don't know what's going on here... I'm not sure if you can see the so so so I'm not sure if you can see the Wow! I'm out. oh my gosh bro so I know I had holy something, bro.
[00:54:30] I had holy something. I'm going to go ahead and do that. Wait, so...
[00:54:32] Hold on.
[00:54:33] Chad, this right here, right?
[00:54:37] If I pop this in my inventory it would just act like a flask?
[00:54:41] Wait can I put this...
[00:55:12] Oh! I know what you sign on so Okay.
[00:55:20] I can't even use holy grease i can't even use holy grease
[00:56:06] wait I can use this multiple times, then like why can't I use it now? Check! chat or is it should be made for the last boss.
[00:56:42] Oh my fucking god. oh my god Hold on, chat.
[00:56:44] Mom sent me some vacation shit. so. chat why is this so annoying bro so Because he's a child of what?
[00:57:56] He just mad that he don't got no fucking friends.
[00:57:58] He just, he just mad that this nigga is all the way in the bottom of a fucking cave and nobody cares about this nigga, bro. That's why he's fuckin upset
[00:58:05] That's why he's fucking mad, bro
[00:58:08] Nobody cares about this guy, bro
[00:58:11] He is in the bottom of a fucking cave!
[00:58:14] All along with a fucking horse. That's not even real.
[00:58:18] Wanna be ass-fucked? I'm gonna be after them all.
[00:59:57] Okay, so we basically have 12 flasks now. so Pussy, look at him! so Oh my gosh bro he's so I hate how you want I'm not sure if you can see it, but the He runs so much, bro.
[00:59:58] What's the lowest I got him?
[00:59:59] Like 20%?
[01:00:02] 20 or like 20?
[01:02:17] Fool! 40? Fuck no! I was below his name. What the fuck?! so so I'm not sure if you can see the so so so so so so so I was trying to see where the fucking hill! I was trying to see where the fucking hill! You fuck-
[01:02:19] I'm about to say it.
[01:02:21] I'm about to say this shit, man.
[01:02:23] I'm about to say this shit, man. I'm about to just say it bro!
[01:02:34] Oh shit Anthony Davis calling me
[01:02:44] AD is calling me ad what's going on busky I'm screaming right now no yeah yeah yo. I was just telling them
[01:02:48] Oh what's it called?
[01:02:50] That I'm gonna be out there for the Olympics and shit
[01:02:52] I'm gonna be streaming, I'm gonna pull up to the game and shit
[01:02:55] Yeah in Paris, yeah
[01:02:58] Yeah I am bruh Yeah, in Paris. Yeah.
[01:03:01] Yeah I am bro! Hold on let me do something real quick.
[01:03:05] I-I AM BRO!
[01:03:07] Say what's up to the stream!
[01:03:11] What up, chat?
[01:03:15] He know how to speak just like somebody on the street That's crazy but hey look
[01:03:19] Bro you gotta pull up bro.
[01:03:22] You have to bruh.
[01:03:25] But whenever you wanna pull up and shit let me know bro I'm gonna be out there though.
[01:03:29] So we can do some crazy shit.
[01:03:32] Alright broski.
[01:03:37] Oh yeah, set me up in that server bro.
[01:03:39] Alright broski.
[01:03:40] Yes sir.
[01:03:41] Alright bet.
[01:03:51] I'm basically in the nba now bro lake is an eight lakers at 17
[01:04:00] like it's at 17.
[01:04:10] I'm calling it right now, in 17. Hello? Come on, bro.
[01:04:39] All right, Chad Lock in.
[01:04:46] Chad Lock in.
[01:04:48] Chad Lock in, bro.
[01:04:49] Let me heal up.
[01:04:50] Let me heal up.
[01:04:50] Let me heal up.
[01:04:57] Let's go. I'm going to go ahead and do a little bit of testing.
[01:05:03] Dukes, they call them. Monty confirmed that.
[01:05:20] Flat S cap. Duke still didn't beat the lion dancer right?
[01:05:27] I wanna see when he beats that-
[01:05:29] Wait, he did?! Who is he on?
[01:05:31] Renella? Oh, ggs
[01:05:35] Romania? What are the fucking names?
[01:05:42] How do you say her name? another how's your name
[01:05:50] pronounce it
[01:07:08] berlana ron so I'm not sure if you can see the so Thanks for watching! so I'm going to have to do this again. Oh, I don't like this nigga, man!
[01:07:21] Don't like this, bro. He's annoying!
[01:07:32] He's fucking annoying, man.
[01:07:46] I'm gonna kill you! so so so so so so so so so so so Oh my gosh, bro. I'm about to crash out on this bitch, bro.
[01:09:57] Oh my god... Yo, who turned out Anthony Davis bro?
[01:10:18] He tried to talk in the chat.
[01:10:26] Somebody timed out AD! I'm not going to let you get away with this. Fossil Bot Timeout AD?
[01:10:49] Yo, ban fossil bot nigga!
[01:10:53] Yo, ban fossil bot bruh! How the fuck you gonna do that to AD, man?
[01:11:03] Time passed about out bro.
[01:11:09] We subbing in. bro
[01:11:11] we stop it in night by
[01:11:19] shit Come on, this shit is ours. Nightmare, it's your turn!
[01:11:21] I wanna go home, man.
[01:11:23] I wanna go home, man.
[01:11:33] Die! Come on, bro. That was a great start, bro! so so so Now watch this. How about this? so so I'm not gonna let you get away with this!
[01:13:12] Bro, bro back the fuck up! Like what are you doing?
[01:13:17] I'm just trying to make sure that I don't die. Like what are you doing?
[01:13:41] I saw Inside Out 2 and it was a great movie. Random ass promo. I really saw that movie though bro, that shit was actually fine.
[01:13:44] I gotta watch the first one bro. so tall Oh my gosh.
[01:14:02] I want to see them myself!
[01:14:07] Now don't go to the movies by yourselves! I want to see them myself.
[01:17:21] Now don't go to the movies by yourselves! so I'm not sure if you can see it, but the so so so Thanks for watching! so so so so so so so so so so No! No! No! No, no!
[01:17:24] NOOOOOO!
[01:17:30] Oh my god that was a good one time use bro.
[01:17:36] That was a good one-time use bro but i was a good one time news chat
[01:17:43] that was a good one-time news bro but i was a good one-time use bro oh my fucking gosh Oh, bro. oh bro so so so I'm not sure if you can see the so so so so so so I'm not sure if you can see the so so so so uh uh Yeah. so huh I'm not sure if you can see the so so so so so so so so so so so so I'm not sure if you can see it, but the car is moving. It's like a Yo, what does Frostbite do?.. Yo, did this nigga...
[01:24:55] Yo, did this nigga Duke post a picture of him doing a fucking backflip? Yo, now I really gonna help you.. Hold on, Chet. I AJ is with Sketch?
[01:26:09] Wait, Sketch is you the ally? AJ IS IN LA?!
[01:26:34] AJ IS IN LA! What the fuck?
[01:26:39] Why didn't you tell me he was leaving?
[01:26:43] Nah, my roommates have no fucking respect!
[01:26:47] ... bet Now that picture of the dude was actually tough, Chad.
[01:27:14] That nigga hit a mid-backflip in the photo! I'ma try that shit.
[01:27:18] Nah, that's glazing. No okay, I'm not doing it.
[01:27:20] I'm not doing it i'm not doing
[01:27:20] it no no no no no no no no that should look fire all right so so so so so so so so so so so so so so so so so so so so so so so so okay 200 Too hungry, too hungry, too hungry, too hungry, too hungry
[01:32:14] Too hungry
[01:32:18] Too hun- I know what i have to do
[01:32:46] too hungry.
[01:33:12] Get food, I ate, I ate, I ate. I was so close, chat. I was so close, chat.
[01:33:15] I was so close, bro. Oh! so I'm not sure if you can see the so I'm going to have to do a little more of this. so so so so so so so I'm not kill you.
[01:35:40] Take this shit out, now!
[01:35:43] Why did I score four slams? Why was it four fucking slabs?!
[01:35:45] Is there always gonna be four slabs?!
[01:35:47] What a-
[01:36:03] ... It's still I can like...
[01:36:10] This, this way.
[01:36:16] Yes! Why haven't I had it like this the whole time?
[01:36:48] Oh my god. Oh my god, I think I know what to do. so so One, one two. Man up!
[01:36:51] One-two.
[01:36:52] Man up, one-two.
[01:36:54] Man up!
[01:36:57] One-two. 12. 12. 12.
[01:38:44] 12. so so so so so so so so I'm not sure if you can see the Help me! Oh, help me! When the time comes when we die
[01:38:46] When they don't think I'm gonna die
[01:38:50] Help me!
[01:38:55] Help me! I'm gonna die! I'm gonna die!
[01:39:08] Oh my goodness I What are you doing?
[01:39:17] Oh my gosh!
[01:39:20] From sunup to sun fucking down.
[01:39:24] I'm experiencing this shit, bro.
[01:39:25] Me. Let me get this shit, bro. Me!
[01:39:26] Let me get this shit the fuck over with my nigga!
[01:39:29] I started talking about it but I can't do this shit man!
[01:39:33] I don't like this SHIT! this so I don't think I understand. so so so so so so so so so so so so so so so so so so so uh so so so so so so so oh I like the water from here.
[01:45:10] Oh, that was...
[01:45:17] Gosh bro! Come on bro! I know what the fuck he's doing.
[01:45:20] What I gotta do is fucking dodge, bro.
[01:45:24] Dodge!
[01:45:25] Dodge!
[01:46:57] Oh! I'm old. oh no bro so so so I'm not sure if you can see the so so so
[01:48:33] stop running Stop running! so so so so so so Bro like he's Bro, like this nigga is just doing Like the most random combos
[01:48:36] Oh my fucking god
[01:48:39] He's doing like the fucking
[01:48:40] Most random fucking combos Yo, mods oh my god he's doing like the most random combos yo mods the
[01:48:43] with some count bro please please Please.
[01:49:01] I'm... Come on, bro. Come on bro, come on! so I'm not sure if you can see the I'm not sure if this is the best way to do it, but I think that's a good idea.
[01:50:02] I don't know what you're talking about, but I'll try my best to get through this one. so so so so so so I'm not sure if you can see it, but the Ow!
[01:51:22] Ow!
[01:51:29] I'm fucking good. oh so so so so so so so so so Oh I'm about to fucking...
[01:53:30] Fuck!
[01:53:43] Shit! Yo! You good bro?
[01:53:45] Fuck no, bro.
[01:53:46] Oh shit you fucked?
[01:53:47] You getting fucked?
[01:53:48] Yes!
[01:53:49] God damn
[01:53:50] He's fucking me up
[01:53:52] You're fucking me up?
[01:53:53] Yes
[01:53:54] What is it, black balls?
[01:53:55] Like finish
[01:53:56] Almost
[01:53:56] Like one more
[01:53:57] Like one more and then the boss
[01:53:58] Damn
[01:53:59] What
[01:54:00] Wait open your eyes.
[01:54:02] You cook bro huh?
[01:54:04] Yo, you really get to sleep on the house.
[01:54:06] Bro yesterday I was sleeping at my crib right?
[01:54:09] I opened your stream up there.
[01:54:11] Bro when I you gonna sleep?
[01:54:12] You're playing the game!
[01:54:13] When do we wake up?
[01:54:14] I don't know...
[01:54:15] You didn't sleep?
[01:54:16] You still play the game.
[01:54:17] It's an honor game.
[01:54:18] You want some crack ass shit.
[01:54:20] You need to sleep bro.
[01:54:25] I like that
[01:54:29] Look in the light
[01:54:33] It looks like you cried, it Like it's not even sweet.
[01:54:35] Your shirt is fried bro!
[01:54:37] Your shirt is fried brother!
[01:54:39] You was hooping?
[01:54:41] Tell them what game you got coming up.
[01:54:43] Uh... You're going to play Razzby, right?
[01:54:45] Nah.
[01:54:46] Bro, stop, bro.
[01:54:46] You need it for real.
[01:54:48] Yes, nigga!
[01:54:50] Oh, that's shit.
[01:54:52] You made me, bro.
[01:54:52] You need to kill me.
[01:54:55] Do it. Arizona? Yes
[01:54:57] Alright, alright
[01:54:59] Last week is a whole
[01:55:01] That's the day I'm gonna play Riot for you
[01:55:03] And after that I'm gonna play F Yo, let me get the uh... You got a flight card right?
[01:55:05] Yeah
[01:55:06] Let me get it bro
[01:55:08] Nah I don't have-
[01:55:09] I don't fucking need this
[01:55:11] Bro if I lose to fly bro
[01:55:13] I'm going-
[01:55:14] My hair...
[01:55:15] Your English got better!
[01:55:16] Hey thank you bro
[01:55:17] Now if I lose the flight
[01:55:19] I think I've gotten my hair pink
[01:55:20] What the fuck?
[01:55:21] Hold on bro
[01:55:22] I think I'm getting my hair pink
[01:55:25] Wait have you lost your flight? If I don't fly I get my hair pink Wait if you lose the fight?
[01:55:27] If I get my hair pink, is that a deal?
[01:55:29] Is that a deal chat?
[01:55:31] Yo if Ray loses the fight
[01:55:33] He's gonna die instead of pink
[01:55:37] Let me dye that shit
[01:55:41] Jack should i dye his hair
[01:55:43] If it's gonna go pink
[01:55:52] I see I think I got it I said cooking oh yeah what the fuck no See? That's why you need to sleep like
[01:56:00] I literally talk to you like
[01:56:02] every single day bro
[01:56:04] Bro
[01:56:06] No, you play too much game bro
[01:56:08] You play 3 days and you already forgot the word bro
[01:56:12] I like it. The flag can't pass
[01:56:15] What flag do you want? Take this ball
[01:56:18] There's gonna be some behind here too, hold on.
[01:56:21] Oh!
[01:56:25] That's basketball right?
[01:56:27] Oh that's ass.
[01:56:29] I see I'm dropping 5
[01:56:31] And like
[01:56:32] 5 in the AU
[01:56:33] Invincible fight?
[01:56:35] 5? You think you can drop 5 points?
[01:56:37] It tough bro, you know they really tough
[01:56:39] But who we are going against? Like Cllysmers no like re-au like some 18 year old and
[01:56:44] ready to go to nba bro you got 10. pain is hard bro i'm gonna drop
[01:56:48] something crash out with the group out. Was it good for today?
[01:56:51] What?
[01:56:52] Was it good for today?
[01:56:53] Nah, I didn't wanna change.
[01:56:53] I went to hoop with Davis.
[01:56:55] And how you did?
[01:56:56] How I did?
[01:56:57] Yeah.
[01:56:58] Not bad, he's high.
[01:56:59] Like what points do you have?
[01:57:00] Now we're play 3v3
[01:57:03] And who won?
[01:57:05] Who fucking won?
[01:57:07] What do you mean, me and Davis?
[01:57:09] No like who won? You said you were the 3v3 right?
[01:57:11] Yeah Who won? You said you had a 3v3 right? Yeah. Who won?
[01:57:13] What do you mean who won?
[01:57:14] Like, you won or you lost?
[01:57:16] Uh... both
[01:57:17] I win some games
[01:57:18] Oh! It was a 1v1
[01:57:20] No, it's 3v3
[01:57:21] We played like 10 games, something like that
[01:57:24] So same team? Same teams?
[01:57:26] No different teams
[01:57:28] Wait what the fuck? You played too much game but you don't know what the fuck
[01:57:32] What are you talking about bro?
[01:57:37] Who's, who don't make no sense me or him
[01:57:41] Damn No he's actually twinking
[01:57:45] Bro!
[01:57:45] He said he had a 3v3.
[01:57:48] Right?
[01:57:49] Okay, which team won
[01:57:51] and which team lost?
[01:57:54] Boss!
[01:57:59] You fucking stupid! yes both can lose yes i know that how about
[01:58:09] okay so how much wins did you get like equal like it's like but it's like 5-4 something like that Oh okay
[01:58:11] You don't count it? I'll be counting every win I get in the fucking court
[01:58:14] Cause I need that shit
[01:58:17] I will count every win in the court
[01:58:19] You don't hoop bro
[01:58:21] you only hoop for like NBA All-Star games
[01:58:23] Okay, first of all Ray
[01:58:25] I was literally in a fight with Well I never seen you in the court. Ray, you see me at the court?
[01:58:27] I have mad mixtapes.
[01:58:28] I have three!
[01:58:29] I have two in America and one in Nigeria.
[01:58:30] You did it.
[01:58:31] And if I won't be with you right now, you getting cooked!
[01:58:33] Hell nah.
[01:58:34] Bro, right now, I'm not even talking about this.
[01:58:35] I'm just saying that I'm going to go out there and do what I want to do.
[01:58:36] I don't care who's doing what.
[01:58:37] I'm just saying that I'm going to get my ass kicked. I'm going to make sure that I'm going to win. I'm going to beat them all. And if I won't be with you right now, you're getting cooked!
[01:58:39] But right now, I'm getting used to it.
[01:58:42] I got the back of my shop.
[01:58:44] So I've got a question.
[01:58:46] When you go hoop in Taiwan or US, who's better?
[01:58:48] Fuck yeah.
[01:58:49] I'm an ass.
[01:58:50] I'm alive.
[01:58:51] The shit I play is like...
[01:58:53] It cannot compare to the US bro.
[01:58:54] Everyone dunking out here but there are some hoopers out here bro.
[01:58:58] Were you hooper at OT?
[01:59:00] Yeah, OT.
[01:59:02] You know what I made? Who? Melo the bouncy guy
[01:59:06] Oh yeah he got braces and shit right
[01:59:08] Nah fuck up He got long hair Yeah, you got braces and shit right? You have braids.
[01:59:11] He be jumping I ain't gonna lie
[01:59:16] He be jumping bro
[01:59:18] 1v1 right now but I can't
[01:59:20] Wait what if they finish I'm playing, I'm playing Fortnite. Wait, uh, when you gonna finish?
[01:59:21] I'm not playing Fortnite, I'm playing fucking Outer Ring, huh?
[01:59:23] Fortnite?
[01:59:24] No, I'm playing Outer Ring.
[01:59:25] See, you game too much like...
[01:59:26] Nah bro cause, but I was in the- yeah bruh
[01:59:28] You only sleep like four hours?
[01:59:31] Like six. And that's it! You can see that I fall. Like 6, and last night I was like
[01:59:35] Last time it wasn't from 3 and I woke up at
[01:59:38] Probably 4 and I woke up at 11
[01:59:45] 4 5 6 7 8 9 10 11 How do you do that?
[01:59:46] That's seven hours!
[01:59:48] It's like waking up for school!
[01:59:49] What time we go to sleep from school?
[01:59:52] Like 12 And what time every wake up yeah we're gonna hop on the game this
[02:00:02] time Same shit chat. We're gonna hop on the game this time Oh Oh, I did see some clips. Which one?
[02:00:14] I forgot.
[02:00:15] Oh no, the two-show one.
[02:00:17] Oh yeah!
[02:00:19] I could dance.
[02:00:21] I got you to better that song right?
[02:00:23] Yeah because I'm at 536 this time.
[02:00:25] Whoa! That's how it is
[02:00:27] like one pair of sunglasses.
[02:00:29] And look at the time, 51 hours.
[02:00:31] I gotta do this boss
[02:00:33] right here and then my next boss
[02:00:38] Is... last one. No, this is it
[02:00:40] and the last one
[02:00:44] Nah nah nah, I got one more, this side one
[02:00:47] Matter of fact! Imma cut the box while you here
[02:00:50] Alright man, do it right now
[02:00:52] Right now! Watch this
[02:00:55] Want a drink? Here.
[02:00:57] Oh shit.
[02:00:59] What the fuck is it?
[02:01:01] You can do that or bang it and then it's your fault.
[02:01:03] Trust me bro Drink that shit
[02:01:08] Yeah
[02:01:10] Alright chat
[02:01:12] Watch this
[02:01:14] That's it
[02:01:17] Aygalar If I do this I know, show me some bro.
[02:01:18] If i do this, Ray got aura.
[02:01:23] If i win this Ray...
[02:01:26] If you lose this, you're cooked.
[02:01:29] Okay, hold on. Watch this bro.
[02:01:34] It said W shorts.
[02:01:37] He's not Eric Kimmigna. I love Eric and Emily.
[02:01:41] Alright, let me lock in Ray! Let me fucking lock in!
[02:01:54] Let me lock the fuck in right now... I
[02:06:07] this one is moving i watched this so so so so so so so so so off so so so so so so so so so so I'm going to get you. No, no, you can't! Oh, fuck!
[02:06:11] What the fuck? First try? Oh shit!
[02:06:15] What the fuck?
[02:06:17] Are you having a big first fight?
[02:06:19] Yes!
[02:06:22] Get in the fucking arm.
[02:06:24] Nah, what the...
[02:06:26] Raya! Raya! Yo! Ray got locked up in the street!
[02:06:27] Ray got locked up in the street!
[02:06:29] Nah, nah, nah.
[02:06:31] What the fuck?
[02:06:32] No no no no no.
[02:06:33] Yo, yo Ray I forgot you was even here.
[02:06:35] I zoned the fuck out bro.
[02:06:37] Oh my gosh! You're not playing bro. He was even here. I don't do shit. No no no!
[02:06:49] You got aura bro!
[02:06:51] No!
[02:06:55] Ray?
[02:06:57] I ain't gonna lie to, you got fuckin' aura!
[02:07:01] Like-
[02:07:02] Wait, you're playing the game!
[02:07:04] No no no
[02:07:06] Wait what? This is the last boss
[02:07:09] Wait how many- Now I'm on the last boss No Wait this
[02:07:10] How many
[02:07:11] Now I'm one of the last boss
[02:07:12] Oh but
[02:07:13] Wait
[02:07:16] It's not finished
[02:07:17] Wait how
[02:07:18] How many try you got like
[02:07:19] No I was on there for like
[02:07:20] He killed me Like 30 times How many tries you got? No, I was on there for like...
[02:07:21] He killed me Like 30 times
[02:07:23] I was struggling with him the whole time
[02:07:25] You walked in
[02:07:27] And first try
[02:07:32] No Hagalaw Ray You deserve this one bro
[02:07:36] Ray I got a lot bro
[02:07:38] Here bro
[02:07:42] Don't smoke it. Don't smoke it but it's in a rack.
[02:07:46] Just act like you're smoking it, all right?
[02:07:52] Up. uh You're the man who was! One more, and I'm gone.
[02:08:04] Yes!
[02:08:06] One more hand.
[02:08:12] Put that on the door!
[02:08:21] Show me your hands.
[02:08:36] Yeah! Let's go! Let's go!
[02:08:44] In my white teeth Hey! Can't touch my no ice tea
[02:08:57] Got a bamboo so like I'm spiky
[02:09:00] Give me more than the angels can find me
[02:09:03] I just call up baby get on high
[02:09:06] Hey! Hey! i better get a high kick Yeah! Alright!
[02:09:30] Yeah!!!
[02:09:34] Man bro, you... That's crazy bro.
[02:09:35] I don't even say it.
[02:09:36] I was struggling with this nigga bro!
[02:09:38] What up?
[02:09:39] I saw us walking. You walkin'? Fuck this nigga bro! What the hell?
[02:09:39] You walking?
[02:09:40] He said, he said
[02:09:41] Beat that shit right now go
[02:09:43] Wait were you even watching?
[02:09:46] Alright be honest
[02:09:49] Nah I see I got live I'll be honest, you don't lose.
[02:09:53] I think... You got a chance to win.
[02:09:55] But I saw you almost sold it.
[02:09:59] I thought you getting sold Brooo
[02:10:01] Cross B go thank you so much
[02:10:03] First, I saw that shade like
[02:10:05] You got it like
[02:10:07] You get hit all the time
[02:10:10] But you get nice, right?
[02:10:11] Yeah, I just like...
[02:10:13] You can put it back there on the rock
[02:10:15] Right here!
[02:10:17] Yo Ray what the fuck
[02:10:21] Hey, remember's less false.
[02:10:25] Now how about this bro?
[02:10:27] Fuck it! Let's call it less false right now.
[02:10:29] Why not?
[02:10:31] And you'll be...
[02:10:33] You can end up safe shit Yeah, I'm free
[02:10:37] Chuck you hear me? Oh my fucking gosh bro
[02:10:41] Oh my fucking god, that's pretty I know laugh
[02:10:45] Last boss hard as fuck though race, bro. He's hot as fuck
[02:10:49] But we might go right now get way harder. He's the last boss
[02:10:54] Yes He's the last boss! That's my...
[02:10:56] My date year ass brother?
[02:10:58] No, I cooked that nigga.
[02:11:00] Mesmerize.
[02:11:02] I dropped him off. That's not her brother though.
[02:11:04] Oh shit
[02:11:05] Put it right there, I think that's good luck
[02:11:07] What you doing sitting there?
[02:11:09] What?
[02:11:11] I don't fucking know
[02:11:15] Yo you broke my shit! Put it right there No, no Put the shark part
[02:11:17] YO YOU BROUGHT MY SHIT!
[02:11:18] Oh shit my bad bro
[02:11:20] Fuck
[02:11:21] My bad bro
[02:11:23] Come on last one bro Last one bro
[02:11:24] Let's go bro
[02:11:25] Let's go One more I'm running out of time bro, last one bro Let's go bro, let's go
[02:11:27] Hot time bro
[02:11:29] You don't give a fuck
[02:11:33] You broke my shit
[02:11:37] Damn bro my bad bro
[02:11:39] My bad bro
[02:11:45] FUCKING SICK! FU-FUCK THAT SUCK NICE Fuck Nancy!
[02:11:50] Fuck Nancy!
[02:11:56] Fuck Nancy! Fuck Nancy, fuck her bitch. LAY ME ON THE GROUND!
[02:12:01] Fuck that shit, fuck up man Alright c'mon let's lock it bro
[02:12:05] Oh shit
[02:12:07] Let's go dude, basketball. Alright, let's lock it.
[02:12:11] Chad I can get another one of those.
[02:12:13] That's 3D made.
[02:12:15] Don't even worry about it Chad.
[02:12:17] It's 3D made, I can get another one of those and I am yo my word Shaq
[02:12:23] i'm gonna pull off a fit with one of them yo wait i want to show you something
[02:12:28] chat look i'ma find out i'ma find the rest of you Chat look
[02:12:32] Imma find the rest of you I got you don't worry about it
[02:12:39] Don't unplug the wifi right?
[02:12:40] Oh shit Imma get it for ya don't worry Don't unplug the Wi-Fi right?
[02:12:45] I'm gonna get it for you. Don't worry, or do you want one new ones made wanna custom one made
[02:12:50] Put on chat imma show you something yeah, I'm gonna remake that right I'm
[02:12:51] going to remake that thing and want to put off a fit together with it let me
[02:12:55] show you
[02:12:59] let me show you. Hold on.
[02:13:03] I'm gonna put up a fit with that. I'm telling you, I'm going to be the first person
[02:13:05] to pull off a fit with gaming shit.
[02:13:07] That's my new drip!
[02:13:09] Yo, hear me out first, Chad.
[02:13:11] We're going to mix it.
[02:13:15] We are going to put that shit on with little gaming pieces. Look, I'm gonna show you look.
[02:13:18] Chat what game is this from?
[02:13:20] What game is this from chat? If you know.
[02:13:24] Y'all see that belt?
[02:13:26] Y'all see that belt on the character right?
[02:13:27] What game is this from chat?
[02:13:37] Ghost of Tsushima, right? Look what I got made.
[02:13:39] Look what I got made.
[02:13:40] Look what I got made!
[02:13:42] Oh my fucking gosh! oh my gosh
[02:13:53] oh my gosh i'm telling you that's my source watch bro watch bro watch and tell me y'all it's about to get crazy but he spits about to get Watch, bro. Watch, bro. Watch.
[02:13:55] I'm telling you all it's about to get crazy, boy.
[02:13:56] These fits are about to get crazy, bro.
[02:13:58] But hold on.
[02:13:59] Why was that actually toast?
[02:14:01] Wait, my first time really looking at it.
[02:14:03] All right, what are you looking for a chair?
[02:14:05] Yeah, yeah, I got you. Hold on here. What are you looking for, a chair? Yeah.
[02:14:06] I got you hold on
[02:14:08] Here just grab this
[02:14:11] Oh fuck
[02:14:13] You fucking rock bro
[02:14:14] Not even deep bro.
[02:14:20] I'll keep it down to the corner swing.
[02:14:25] It's different right? You fuck with it? Hell yeah!
[02:14:28] No, no!
[02:14:32] Look like this bro
[02:14:36] Bro you good bro?
[02:14:39] You been hooping too much bro.
[02:14:41] Nah I only cooked about two things
[02:14:45] I need you to cook bro
[02:14:49] I swear to
[02:14:55] No, I'm trying to see. Shit! I went over the race game bro Again?
[02:14:59] Nah fuck Again? Yeah! I want you to pull out one more.
[02:15:00] Nah, fuck you.
[02:15:01] Shit. I ain't allowed to cook right now.
[02:15:02] I don't care.
[02:15:04] I got-
[02:15:05] If you go and you cook bro...
[02:15:07] Bro.
[02:15:08] If you go
[02:15:09] And you cut these...
[02:15:11] No all we need is like...
[02:15:13] How much points does Ray need?
[02:15:14] All you need is to play 15 bro.
[02:15:16] Fifteen?
[02:15:18] Twelve!
[02:15:20] Yeah all you need is one field goal, 1-3 Yeah all you need is like
[02:15:21] 1-3
[02:15:23] A 3
[02:15:27] Every single day and I'll go to Mixed Day
[02:15:29] Oh you want to mixtape?
[02:15:32] So all you need, like you only need two drinks then
[02:15:34] All you really need is just
[02:15:36] I can do some dribbles
[02:15:38] Pass it to somebody
[02:15:40] But after that fight it was going crazy on Instagram
[02:15:43] I think i've seen that shit
[02:15:45] They gone crazy on the live
[02:15:46] You got motion right?
[02:15:48] You got motion
[02:15:50] You put me out in a motion
[02:15:52] You put me out in a motion I'll put you out on the motion. Huh? You put me out on the motion.
[02:15:53] I'll put you out with the motion?
[02:15:55] No, no, no.
[02:15:57] God puts us all in with the motion.
[02:15:59] Like, because like God really did.
[02:16:01] Yeah he really did.
[02:16:05] He really did chat., he really did chat like he really did. All right.
[02:16:06] First time.
[02:16:07] I love it.
[02:16:08] I love Ray.
[02:16:09] If we do some crazy about a happy.
[02:16:12] I don't know bro it's some chick
[02:16:14] music if so crazy happens right now you're gonna go bro
[02:16:20] yes if i beat like it was not good if i did a good try in right now...
[02:16:24] You're the GOAT.
[02:16:29] Oh no, I wasn't there!
[02:16:32] I know some moves but I got my ass whooped.
[02:16:36] But yeah, I really don't know oh yeah Oh.
[02:16:52] All right, chat. Any upgrades?
[02:16:54] How much did he give me?
[02:16:56] 220,000.
[02:16:56] OK.
[02:16:57] Final upgrade!
[02:16:58] What matters the most?
[02:17:01] Holy fuck.
[02:17:05] What matters the most like the most bro?
[02:17:13] Bro i can't believe you just...
[02:17:15] I can't believe you really walked in and just let me win like that, bro.
[02:17:21] Oh, I was struggling with that nigga, son!
[02:17:27] Look, he's struggling!, look Ray. This nigga is struggling.
[02:17:31] Who's that?
[02:17:32] Some random person online they show you some online characters like
[02:17:35] Right now?
[02:17:36] Yeah but I can't hit him on anything cause he just doing the same thing I'm doing Look he's like i can't hit him with anything because he's just doing the
[02:17:39] same thing that I'm doing look he's struggling bro look
[02:17:44] all right
[02:17:46] oh what's next chat here we Here we go. I can leave right, I can leave!
[02:17:54] Oh shit...
[02:17:56] Here we go bro
[02:17:58] You breathe that shit today you out
[02:18:00] Oh bro Bro, if you breathe that shit today, you out. Yeah so sad bro...
[02:18:02] Oh they said go in cave!
[02:18:04] Wait what's in cave? Fuck!
[02:18:07] What's in the cave? What's in that cave? I have a chance.
[02:18:25] What's in that cave, bro?
[02:18:32] Oh lord shit! Alright we gotta go back.
[02:18:34] Yeah it's like...
[02:18:35] It's like-
[02:18:36] It's like lore shit
[02:18:42] Ah shit Bro I'm getting caught.
[02:18:44] Bro, like you look like...
[02:18:48] You know how big that was bro? Big as hell!
[02:18:52] That was equivalent to like Kyairi shooting at final three for Cavs.
[02:18:56] Oh, that's a good one!
[02:18:58] Like chat right?
[02:19:00] Like LeBron James chased out block.
[02:19:02] Yes!
[02:19:03] Yes!
[02:19:04] Oh my god yes
[02:19:09] which one
[02:19:12] which one is it
[02:19:22] deep purple huh Deep purple. Huh?
[02:19:29] Alright bro
[02:19:35] I ate There's the cave right here so What the fuck is this?
[02:20:02] Imbibe nectar? Huh? Her head is right there
[02:20:25] do it six times do it four times Yo!
[02:20:36] What does that do? Did this shit add to my fucking death counter?
[02:20:58] Does it make me fat- does it make me fat does it make me like stronger
[02:21:12] wait what do you mean it's removing my frags?
[02:21:21] Hold on. Taluk's calling me! Yo! Yo!
[02:21:35] Yo!
[02:21:37] Yo!
[02:21:41] Yo!
[02:21:47] Yo! Cat what's going on cat?
[02:21:51] Cat!
[02:21:58] Cat! Get! I bet, time three hours I said thank you.
[02:22:04] Alright but yeah I got your shit.
[02:22:08] Alright, but...
[02:22:09] Talil!
[02:22:15] Talil!
[02:22:17] Hold on nigga, let me talk to Anthony Edwards bruh!
[02:22:21] Let me talk to Anthony Edwards! Alright bro
[02:22:30] Oh my gosh
[02:22:34] Travis Scott
[02:22:35] Travis Scott Scott!
[02:22:43] Travis Scott, Carl Anthony Towns.
[02:22:45] I'm glazing.
[02:22:47] Nigga, I'm a viewer.
[02:22:49] How's it house? That sounds like the Edwards. Nigga, I'm a viewer. Nigga, I'm a fucking viewer! You see-
[02:22:53] What?
[02:22:59] When did you come?
[02:23:02] Did anybody see him else?
[02:23:04] When did he walk back in?
[02:23:07] You didn't see me?
[02:23:09] I said I saw me.
[02:23:13] Oh yeah, I thought you left! To get food!
[02:23:15] Nah, I got Uber right now.
[02:23:17] Yo wait no, that was good, I was calling Anthony Towns
[02:23:21] But, but, but... I thought that was
[02:23:21] Anthony Edwards.
[02:23:22] Anthony Edwards?
[02:23:24] Yeah, he about to call back.
[02:23:26] Oh shit.
[02:23:26] Come on.
[02:23:28] Oh, Anthony Edwards!
[02:23:29] Go, go, go, go, go, go.
[02:23:30] Go, go, go, go.
[02:23:31] Hurry up. Hurry up. Hurry go go go go go Hurry up
[02:23:34] Come come come come
[02:23:38] You're glazing
[02:23:40] I've been glazing bro.
[02:23:45] I had to take a picture real quick, cause you was glazing just now.
[02:23:47] I was glazing bro?
[02:23:49] Yeah, he was glazing just now.
[02:23:52] Had to take a picture of that.
[02:23:55] Come on, there's no Gla1ce or LeBron bro.
[02:23:57] Like who is your best favorite player?
[02:24:00] Right now probably Shea.
[02:24:02] Yeah, probably Shea. Probably OKC. Yo! I'll be safe
[02:24:08] Okay, yo mama words wanna go to WWE too!
[02:24:14] I watch that shit today. Uh Clark and uh
[02:24:17] Reese
[02:24:18] Angel Reese
[02:24:19] Yeah they play today
[02:24:21] Oh my god
[02:24:22] Wait I know
[02:24:23] What game you want to go to? Chicago?
[02:24:24] Like Angel Richie right or Clark?
[02:24:26] Or you don't care?
[02:24:28] Clark bro. I'm in Clark bro
[02:24:30] Clark?
[02:24:31] I only watch the last 24 seconds
[02:24:33] Nah I ain't going... Oh my god Oh the last 20 seconds no i go oh my god oh the last 20 seconds the last 24 seconds
[02:24:43] you only watch the last 24 seconds? Yeah.
[02:24:52] Want some bubble tea?
[02:24:54] I fucking hate bubble tea, bro. What the fuck?!
[02:24:55] You always tell me to get that!
[02:24:56] I don't want it!
[02:24:59] Bro, bro, bubble to his ass bro.
[02:25:05] Wait Jack is anybody- Is any matters in my rules?
[02:25:07] In my frags?
[02:25:08] You said what?
[02:25:13] Oh no it's not.
[02:25:15] Nah I don't know why I didn't like bubble tea bro
[02:25:17] I think I had the one in Taiwan
[02:25:19] It was bad
[02:25:23] Someone want to try it again?
[02:25:27] Alright, auto me one Auto me one I oughta, oughta move on.
[02:25:31] Imma try it one more time.
[02:25:33] Two more times back!
[02:25:37] I didn't leak Cat's number.
[02:25:40] Cat didn't call Tyler's number. Cat didn't call... Talil's number is saved in my phone
[02:25:42] No number leaked
[02:25:48] That nigga Tyzzy That nigga Tyzzy, man that ties it that ties the cameras right now he's at paris lit right now boy Oh my god, I know what you're doing! so Wait, they wanted to get paid.
[02:26:28] Oh my god! They people are saying it's lore people are saying it's not I'm gonna fucking get out of here. Oh, fuck. No.
[02:27:18] Mikhail, stop.
[02:27:24] Don't hurt the pool into a gulf.
[02:27:36] Oh, y'all was right.
[02:27:37] Wait.
[02:27:39] Wait a minute.
[02:28:00] What? so Two more? But what?! so One more?
[02:28:36] What is thought to be Nicholas' prison.
[02:28:45] A cage divinity is beyond saving.
[02:28:53] Yo, what the fuck? This is crazy!
[02:29:04] Boom! They get... oh they how did somebody else find this out
[02:29:10] last one so You must carry me, Hilda.
[02:29:42] Brought to him full strength. Grant him forgiveness.
[02:29:54] That shit just gave me chills.
[02:29:59] That shit just gave me chills, bro.
[02:30:04] That shit just gave me chills, man.
[02:30:09] Wait! Okay so let me understand something alright?
[02:30:15] Where's Mikala?! where's mickela
[02:30:25] yes i'm saying that means another DLC bro.
[02:30:29] Another one is coming!
[02:30:34] Is that it? Is that it?
[02:30:36] Is that it is that it
[02:30:43] well there's no way bro another one another outer ring but there's no way
[02:30:47] i'm playing another another marathon of outermost right chat there's no way I'm playing another marathon of Outer Ring, right chat?
[02:30:49] There's no way I sit down for hours and do it again, right?
[02:30:52] For another DLC.
[02:31:23] There is no way. You must carry me, Gilda.
[02:31:40] Grant him forgiveness. You must kill that nigga. Uh,
[02:31:43] grant him That nigga, uh... Grant him forgiveness.
[02:31:51] Alright chat? look at this map.
[02:32:02] Chat I love you guys so much, understand me?
[02:32:06] No matter what's about to happen
[02:32:09] I want you guys to know
[02:32:11] That i love you guys so much okay
[02:32:13] No matter what's about to happen, bro.
[02:32:19] I don't know how my emotions will be
[02:32:21] for this time
[02:32:25] bro
[02:32:32] I I'm not sure if you can see the background noise. It's a little bit of an so so so so so I'm not sure if you can see the so Yo! You! Yo, you... I can't even hit this nigga.
[02:34:16] Yo! I can't even hit this nigga man! Holy shit. uh so so so so oh
[02:35:36] holy shit!
[02:35:42] I gotta study his moves bro.
[02:35:47] Oh we're in a good point right now.
[02:35:49] He's the last thing in our way, chat.
[02:35:51] He's the last thing in our way, bro.
[02:35:56] He's the last thing in our way.
[02:37:13] Oh, my God. He's lasting in our way. so so so so so That's fine, that's fine, that's fine. That's fine. That's fine. That's fine, that's fine.
[02:37:17] That's fine. That's completely fine. That's fine.
[02:37:19] That's fine.
[02:37:58] . so uh so Fuck! Come on, come on, come on, come on, come on, come on, come on, come on, come on, come
[02:38:12] on. Bro that right E my nigga like damn
[02:38:20] and they probably gave up from hooping all day bro let that chill chill you're gonna come downstairs so Goddamn! god damn Fuck! so Whoa, bro! I got to learn them. I got to learn them.
[02:39:42] I got to learn them.
[02:39:43] Is it better to remain close or distant. I'm going to try dodging.
[02:40:07] I'm only going to hit and fire and open ass the guy. get a fire so I'm not sure if you can see the so so so I'm just playing for defense. so so I'm sorry. Fuck!
[02:42:15] I'm learning him, though. I'm learning him. so
[02:42:32] what on chat I'm going to go ahead and do that. All right, here we go. uh I'm not sure if you can see the so so so I'm not sure if you can see it, but the game is still running. Fuck!
[02:44:11] Damn!
[02:44:14] This thing is a tank.
[02:44:17] He's a fucking tank bro.
[02:44:19] I'll get that fucking stamina my nigga unlimited
[02:44:22] fucking rolls so so so so so come on so so so so so so so Fuck!
[02:47:05] Ah shit chat, FUCK! fuck so Oh, there's two guys over here or something.
[02:47:38] Come on bro!
[02:47:47] Yo, what if I pop the millennials rune?
[02:47:49] Whatever the fuck that shit. The rune.
[02:47:51] First phase like...
[02:47:52] Is it gonna damage him a lot? I know I'm supposed to be using the techy phase but
[02:47:54] Is it going to damage him a lot? Does it last your whole life?
[02:48:17] Or one phase? so I didn't even stand myself.
[02:48:44] I didn't even stab myself.
[02:48:49] I didn't stab myself, motherfucker!
[02:50:11] I didn't even stab myself, fucker! so so so so so so Yo, how do I like escape?
[02:50:17] After the gravity pull where he does an excellent swordsman and strikes.
[02:50:19] Do I dive into him?
[02:50:28] But this shit is strike- Like the gravity shit is fucking me up. Roll before to pull. Wait, what?
[02:50:45] Go back a little.
[02:50:50] Oh! so so so so The so so so so Oh my gosh, bro.
[02:52:37] Holy fuck!
[02:52:41] This combo is messed up! Holy fuck! His combos do not stop, chat.
[02:52:44] Bro his combos
[02:52:45] do not fucking stop bro.
[02:52:47] Wait hold on what? Okay
[02:52:49] What gravity pillow y'all talking about? The main gravity pull if I'm across the map,
[02:52:53] I go to him or the close one. Which can I roll out of?
[02:54:10] Both Both. so so so so I'm going to have to do this again. He's fucking me up, man. Oh! so so I'm not sure if you can see the so Oh fuck! I've been to the second stage, I know.
[02:55:13] Second stage hard as fuck, I know.
[02:55:17] Damn, I done been
[02:55:17] to the second stage, that's crazy.
[02:55:24] I see you That's a second phase, that's crazy.
[02:56:15] Oh god I have! He looks all broken down and his face shows... ah i know so oh Damn! Damn! Damn! so so I'm not sure if this is the best way to do it, but I think you can get a lot of points for that.
[02:56:53] I don't know what's going on here... I'm out. Bro he does not fucking stop!
[02:57:10] What the fuck?
[02:57:15] Bro his combos, Am I bugging? so so I'm not going to let you get away with this. Your heat does not stop! so so so so so so so I'm not sure if this is the best way to do it, but I think you can just go with what's in your inventory.
[02:59:33] I don't know why they're doing that here... What? I could've sworn I was putting him in pain just now! Fuck. Fuck!
[03:00:15] Have I even been popped a rune art? so so so Oh my gosh, bro! This nigga is moving my ass!
[03:01:22] Oh my gosh. chat this is my bro This nigga is with my ass, bro. Hold on, I need a break. so.. so so I'm going to have to do this. I live on the moon
[03:03:19] Yo, is there an easier way to put the rune somewhere? like i could put it somewhere Wait, how come I get a turret? so so Oh my gosh! I gotta remind him who the fuck he's talking to, though. so so I'm gonna sure if you can see the so so so so so so so so so I'm not sure if you can see it, but the so I'm so fucking good.
[03:08:02] Is he weaker?
[03:08:05] Is he weaker?
[03:08:20] His his, okay I have S. All this is to Sunny bro. Sunny's the only nigga who keeps shit a stack!
[03:08:24] The spy removed with the old order
[03:08:28] If you have no reason if if you call off this war...
[03:08:33] Wait did I see this?
[03:08:35] Then lead the path forward to us.
[03:08:41] WAIT! Wait! I said on guard, I apologize.
[03:08:47] I never see this I'm going to go ahead and do that. so Okay, now I'm saying is he weaker in terms of my hits hitting him?
[03:09:31] Like you know how bosses get weaker?
[03:09:40] Hold on. Hear me out bro
[03:09:43] So let me study that real quick so what I saw was absolutely fucking ridiculous
[03:09:50] correct me if i'm wrong um when I ran into there- When I ran into there...
[03:09:57] Hold on. When I ran into their chat
[03:10:01] It was one shot
[03:10:04] Do I have to run out of that circle Is there a circle, is it like an elven beast?
[03:10:13] Do I gotta run out of it? Okay.
[03:10:23] My runes still lasted
[03:10:25] that whole time, right?
[03:10:33] Hold on how about um
[03:10:39] Yo, how do I... Always Monet.
[03:10:41] Always Monette with the motherfucking 25
[03:10:43] get to appreciate you.
[03:10:45] Thank you so much. Always Monette.
[03:10:56] They sort of 25 gifted, appreciate it.
[03:10:57] W25 fucking gifted. All right, all right chat hold on i got a question
[03:11:03] how do i do the touring so I don't understand that's a turret! so so so You might as well eliminate the horse. You might as well eliminate the horse.
[03:12:25] You might as well eliminate the horseshit right now and put this because you can't use
[03:12:28] a horse anyway.
[03:12:31] So it's easier, we might as well go like this.
[03:12:39] Fire. so it's easier, we might as well go like this
[03:13:03] I'm more accustomed to the horse though I'm dumb ass.
[03:13:11] My dumb ass, come on KC, come on KC!
[03:13:13] Come on KC!
[03:13:19] Say it bro for what?
[03:13:24] It lasted the whole time!
[03:15:19] Right? so I'm not sure if you can see the so so so so I'm not sure if you can see the so AAAAAAAAHHHHH! I see this right now, bro!
[03:15:59] I know what you're doing right now, bro! I'll save it. so Hey! Fuck! Okay, so
[03:16:01] what I like about
[03:16:03] what they did was
[03:16:05] they let you get to phase 2
[03:16:09] 75% which is great
[03:16:13] I don't know, I don't know if that's good or bad
[03:16:15] That's pretty good right?
[03:16:17] Like it's technically bad but like...
[03:16:20] You feel me?
[03:16:21] That that's actually good that they let you get to phase two.
[03:16:25] It's technically bad but like it's refreshing.
[03:16:31] Why would I do this? refreshing. Why are they in the chat app
[03:16:33] when they fucking know everything about it?
[03:16:35] Like, oh my gosh!
[03:16:39] Wait I have a headache
[03:16:42] I need painkillers
[03:16:44] Fuck Yeah let me go and see if there gets some water, I'm buggered bro......... Yo chat, my eyes are dead ass fucked up.
[03:18:30] Chat, my eyes are fucked up bro.
[03:18:34] What you want? Let me come here.
[03:18:45] Huh?
[03:18:48] My eyes, right?
[03:18:51] Let me see it on.
[03:18:58] Ah, this shit hurt, bro.
[03:18:59] Fuck. Fuck. i should hurt bro fuck
[03:19:06] tell my aunt like it hurt it don't hurt but like And when I walked out just now, like,
[03:19:17] I couldn't, like, maneuver.
[03:19:19] It's weird.
[03:19:25] Oh. maneuver. It's weird. Light off? Fuck no!
[03:19:29] Fuck no.
[03:19:38] Why? Because it's better to shoot with it better shoot with the light on bro I'm not sure if you can see it, but the enemy is moving. I don't know what's going on here. I think they're trying to get me out of this place. I don't know where they are. I don't know where they are. I don't know where they are. I don't know where they are. I don't know where they are. I don't know where they are. I don't know where they are. Fuck! come on boy come on come on come on so uh so so so so Fuck!
[03:21:35] Fuck!
[03:21:51] The End Come on. Come on! Come on! uh Oh my god, like what the fuck?
[03:22:26] Bro this is like his combo.
[03:22:28] Bro come on bro, they gotta have some type of open gaps bro.
[03:22:33] Like look I got gotta get in there,
[03:22:34] bro! Like, what the fuck?
[03:22:35] ...
[03:22:37] ...
[03:22:39] ...
[03:23:59] ... so so so so so so oh bro, like what? Bro he does not
[03:24:01] stop.
[03:24:03] Dang he does not fucking
[03:24:04] stop.
[03:24:42] Bro he does not fucking stop. so I'm not sure if you is the best way to do it, but I think you can get a lot of points for that.
[03:25:20] I don't know what's going on here... so so I'm not doing shit to this nigga over here It's like, I'm not doing shit! so so so so Bro!
[03:26:32] Not alive? Bro!
[03:26:42] I might need to rebuild, bro.
[03:26:51] What do i need? More dexterity my nigga? Do i gotta max out my fucking
[03:26:55] vigor, arcane, dexterity and fucking like what?
[03:27:14] I feel like my damage is not enough. Yeah, I'm trading this one if I get the P-Shader.
[03:27:17] Yeah, I'm trading.
[03:27:18] I feel that my damage ain't enough. Different weapons.
[03:27:35] But, X you see when he beat this nigga bro?
[03:27:44] That's crazy as fuck.
[03:27:50] That's my juicer.
[03:27:55] Yes he did! He said he did! Right?
[03:28:08] Yeah, he did.
[03:28:11] He's tough!
[03:28:13] How long it take to beat it?
[03:28:14] Nah, he's tough bro.
[03:28:18] And you got phase fucking sway!
[03:32:25] You can't do that. You got face weights, man. so so so so so oh my gosh Ugh. I'm going to have to go get some food. ah uh so so so oh so so so so so so is so Oh my gosh, bro.
[03:32:28] Why you not... If you died that one. Why can't you fucking duck why are you getting hit?
[03:32:33] Why am I gonna get still why am I gonna hear it?
[03:32:35] Why am I gonna hit my dot if I'm not if I dodge the second pool, why the fuck am I still getting hit? so Holy shit, man.
[03:36:29] Mods, please plant it until sub count just have one focus on it I'm not sure if this is the right way to do it, but I think that's a good idea. so so No! oh Yay there's a so so oh my gosh holy so so so so so so so Oh my gosh, King.
[03:36:30] What the fuck?
[03:36:32] This nigga is ass, bro.
[03:36:34] This nigga... Bro, What the fuck
[03:39:04] Fuck so so so Oh, my fucking gosh. so so so so so so so Oh my God, one more.
[03:39:05] One more.
[03:39:05] One more.
[03:39:07] He's the last one.
[03:39:09] He's the last one bro.
[03:40:44] He's legit the last one. so He's the last one. I'm not sure if you can see the so so so Thank you for watching. Oh shit! Well, if I didn't say I want to take a break, don't tell me to take a break.
[03:40:46] Like come on bro.
[03:40:53] Yeah, I told you to take a break. Don't make me wanna take a break. I'm going to if you can see the so I'm doing.
[03:41:54] Oh my fucking gosh. the Duke rage quit again I wanted to see somebody else struggle, bro.
[03:42:22] He rage-quitted again? Oh, he was on the hippo!
[03:42:33] Wait has he been off-lighting it?
[03:42:37] Wait, Duke have you been off-lighting Eldar Ring? so. Luke, you've been offlining out already.
[03:43:20] You know what that means right?
[03:43:25] Do you know what the f***ing mean is one of ya?
[03:43:33] Hey look, I have eight.
[03:43:37] I just wanna watch him play that shit!
[03:43:39] I wanna watch him struggle my nigga.
[03:43:43] I wanna watch my fellow friend struggle too, bro.
[03:43:47] Like, Duke, he should be up...
[03:43:48] Bro! He should be upstairs
[03:43:50] singing this shit, bro.
[03:43:53] Now, I want to see that nigga struggle, gang.
[03:43:57] That ain't El Maz, that's a real nigga.
[03:43:59] And I just got my retwist right?
[03:44:01] And my shit about to fuck up, bro. I i haven't got a retweet in like three months
[03:44:05] my shit about to be my shit about to be fucked
[03:44:10] yo yo remind me when i go to sleep but i have a body
[03:44:13] if i sleep because if i beat this nigga it's lit! so so so I'm not sure if you can see this, but the game is still running on a lot of so uh so so I'm not sure if this is the right way to do it, but I'll try.
[03:46:09] Whoa! How was this any space?
[03:46:13] How is this any space to hit him?
[03:46:18] How?!
[03:46:21] This... There's no...
[03:46:25] There's no hitting him. You can't! so so Thanks for watching! so so so so so so so so so so I'm not sure if you can see the Come on, bro. so so so so so so I'm not sure if you can see the so so so Oh my gosh!
[03:51:38] Oh my fucking gosh, man.
[03:54:08] Oh my fucking gosh, man. oh my gosh again oh my gosh bro so I'm not sure if you can see the so so so so Oh, my God. Oh man! so so so Oh my gosh! Don't stop.
[03:54:14] He doesn't stop. so so I'm gonna have to go up there, bro. Wow
[03:55:00] I have to go level up my nigga, i'm gonna have to go level up bro
[03:55:04] I'm going to upgrade. I'm going to have to go level up, bro.
[03:55:05] I'm gonna have to upgrade.
[03:55:07] I'm gonna have to go farm and shit.
[03:55:13] Huh?
[03:55:18] What?
[03:55:22] I'm a half-suit, bro. How much room should I stack, bro?
[03:55:28] The logic is loading.
[03:55:44] Okay. No, levels won't help.
[03:55:45] Levels only help but to a certain extent it does bro
[03:55:50] oh my god okay what can we do okay hold on let me see
[03:55:54] where where okay what do we need the most out of everything dexter quick it's like what do we need bro
[03:56:17] what two if you're gonna say two things what two things would you we need
[03:56:24] holy What?
[03:56:38] Frags and debt. Hey, gorsh.
[03:56:41] Frags and dex?
[03:56:44] Why you saying frags and dex bro?
[03:56:46] Why you even saying frags m0nigga?
[03:56:48] We don't need no flags how much time buses we got left but ask me that law the but it has to be well i have a lot
[03:57:03] there has to be somewhere where this trash is laying around there's no way there's no way.
[03:57:19] So there has to be somewhere... Where is this?
[03:57:20] Hold on bro, let me see how much frags I got.
[03:57:24] I don't even think I've how much frags i got i don't even think i got any franks
[03:57:36] i don't have frags, right?
[03:58:21] 80 thousand. Hold on, 80,000. so so Come on, come on, come on. 500... that's $7.
[03:58:23] What's 500 times 7?
[03:58:26] What- what's 500 times seven?
[03:58:27] What's 500 times seven?
[03:58:34] 3,500.
[03:58:39] 75,000. 75 22
[03:58:47] . Yo, I beat phase one.
[03:59:01] Can I?
[03:59:02] Am I able to just watch some like can I
[03:59:04] walk somebody get past phase 1 that's it though.
[03:59:06] I don't want to watch phase 2 or no. Like, I don't even see how sway Or no?
[03:59:13] I don't even see how Sway did this shit.
[03:59:17] Well, I already wanna see how much damage them niggas is doing. That's it. Now I wanna see
[03:59:19] how much damage their weapons is doing.
[03:59:21] Bro, I hate my chat.
[03:59:23] Y'all never let me do shit!
[03:59:34] I literally got past phase one! What's the fucking difference? I GOT PAST IT! I hate this poll bro.
[03:59:58] Fucking stupid ass fucking game! this game I wanna go to the park bro, I wanna go to the movies bro!. so Well let me guess, your broke ass don't have no rules huh There's no way I'm about to lose this rune, bro.
[04:01:14] Chat there is no way I am losing these runes my nigga.
[04:01:17] I gotta hit the farm real quick. There's no way I'm losing these runes, my nigga.
[04:01:19] I gotta hit the farm real quick.
[04:01:59] There's no way. Get the fuck outta here. so so Am I just not fucking good enough, my nigga? Am I just not fucking good enough, bro? Don't ask me how I know how to do that so well.
[04:02:25] You out?
[04:02:28] You about to go sleep?
[04:02:29] Me?
[04:02:32] Yeah, you want to like relax? You wanna relax relax? What did I say to you bro? Me?
[04:02:32] You wanna relax
[04:02:33] In your bed
[04:02:35] Yo
[04:02:35] And be my meat
[04:02:37] Nah, I just kidding though
[04:02:39] Do you know how bad I want to be my meat bro?
[04:02:41] Bro, I know how you feel but
[04:02:43] Stop that I know how you feel but I don't win. Stuff like this, you'll get in a struggle bro.
[04:02:47] As soon as you get out...
[04:02:49] If you beat out on me?
[04:02:51] I will never play again.
[04:02:53] I mean I would but I won't be out of the ring.
[04:02:55] If you'd be out of the ring
[04:02:56] I'll give you $100,000.
[04:02:58] Beats again?
[04:02:59] 100K?
[04:03:01] Oh hell yeah!
[04:03:03] Hell yeah, I'm doing that shit bro!
[04:03:04] Alright... You make it. Hell yeah, I'm doing that shit bro.
[04:03:08] You mean like do a dumb dub? I ain't gonna lie bro, I think you know what we did well it's hard bro.
[04:03:13] What the fuck, you don't believe me, I'm a gamer, bro.
[04:03:15] Yeah but like it takes a different level of like...
[04:03:18] Like brain
[04:03:19] If you can do it, I can do it
[04:03:21] That's a fact!
[04:03:24] It only like...
[04:03:27] Would you marathon it? Or would you do it in one go?
[04:03:31] In one, other ring
[04:03:33] 100k? Hell yeah bro
[04:03:37] What the fuck that's how they play bro
[04:03:38] What the fuck
[04:03:40] Okay
[04:03:40] But
[04:03:41] If you quit
[04:03:42] You gotta do something though
[04:03:44] If I quit
[04:03:45] I go involved.
[04:03:48] Bro, I would never get out without 100k bro!
[04:03:51] I mean, I was struggling in the game but I wouldn't ever get out bro with 100k bro.
[04:03:55] I sell money bro.
[04:03:57] So you don't think he'll be able to beat it? Hell yeah bro! I sell money bro
[04:03:59] You think you'll be able to beat it?
[04:04:01] Hell yeah
[04:04:06] You don't think i'm gonna beat it
[04:04:08] But this shit is hard as fuck, bro.
[04:04:08] Not really like it's hard.
[04:04:10] Yes.
[04:04:12] Hold on let me see people walking and I'll beat them real quick.
[04:04:17] You're here already. Let me see if I beat it.
[04:04:20] Oh my God, I can't see it bro.
[04:04:22] Ah fuck alright.
[04:04:23] I want to do this though.
[04:04:26] Alright thank you bro.
[04:04:28] I hope I get to see you tomorrow bro.
[04:04:29] Nah, I wanna get up today. Today? I hope I can see you tomorrow bro.
[04:04:30] Nah, I wanna get up today.
[04:04:32] Oh, today?
[04:04:34] You got 30 minutes.
[04:04:36] Oh it's Gigi's.
[04:04:37] You got 30 minutes.
[04:04:38] Yeah, I hope I can see you today today or tomorrow morning.
[04:04:42] I'll see you, Brody.
[04:04:44] I say goodbye.
[04:04:46] Lucky bro! so I'm going to go ahead and do that. You and me, Mr. Grinch. so so Thank you. so you like to fuck so so Yo, am I fucking dumb?
[04:06:55] Use Elden Beast Sword.
[04:06:55] Is it good?
[04:06:58] But what purpose is good for this shit, man?
[04:07:01] Please bro let me know Jen. Let me know! How much more do I need for my next level up, chat.
[04:07:26] 2-5-7. Almost there. So why is this shit so hard, bro? Yo, Sonny! Please look to see if there's any strength. If there's any like... Oh my god you wouldn't be able to know I noticed fragments laying
[04:08:06] around somewhere bro there's no way yet is no wait good look
[04:08:12] okay so how much does Bailey have?
[04:08:16] Chat, how much does Bailey have chat?
[04:08:19] That boss. How much does he have? Can we see what bosses have what?
[04:08:38] Because no, do the math!
[04:08:40] Cause if there's two more sidebosses I'm so mad.
[04:08:48] They give a Blitzcrank?
[04:08:56] Listen, if there's two more sidebosses that means the rest of the frags are just lingering.
[04:08:58] So if we can go
[04:08:59] get that
[04:08:59] let's go get
[04:09:00] that!
[04:09:04] Agreed or
[04:09:04] disagreed?
[04:09:09] Okay or disagree? Like, let's go
[04:09:10] get that.
[04:09:22] Sonny, I don't know if you'll be able to find that or any mods. I don't know if there are people who know where the fuck to find that shit.
[04:09:25] What am I upgrading, chat?
[04:09:39] I think dex is the most important thing to upgrade right now? Like, really?
[04:09:41] Like 100%?
[04:09:43] It has
[04:09:44] To be. Because my shit's
[04:09:46] My damage ain't doing shit
[04:09:47] Okay, hold on. See I have to go rebuild something real quick what could i sacrifice
[04:09:56] what can i sacrifice to put into my dexterity.
[04:10:04] Wait!
[04:10:07] Hold on, where should be- Where should my Dex be at?
[04:10:14] Where's like the okay this is good thanks
[04:10:27] 60 50s oh so low So my shit low? Fuck. so... I'm sorry.
[04:11:27] Chat! So what's the game plan? Higher decks, fine rules.
[04:11:31] Right?
[04:11:35] ... New weapon.
[04:11:38] New build?
[04:11:40] No, but I can't sacrifice anything!
[04:11:43] What would I be able to sacrifice?
[04:11:49] I don't know
[04:12:00] no arcane gotta get kept bro. Y'all done seen the difference with Arcane.
[04:12:02] No y'all seen the difference with Arcane bro. 55 Art,
[04:12:29] 55 Vagor.
[04:12:31] Wait so you're saying
[04:12:32] 55 arc
[04:12:33] 55 Vagor
[04:12:36] that throws 10
[04:12:38] on decks right?
[04:12:51] So what would'd be like 46 boy a chamber We need to upgrade this dex.
[04:12:51] We just gotta upgrade this dex bro.
[04:13:04] 45 endurance.
[04:13:05] I said it's at 41.
[04:13:09] No, look!
[04:13:10] Okay, look.
[04:13:12] Levels do not matter 100%. Levels do not matter right?
[04:13:16] But the attributes do my nigga!
[04:13:18] So they technically like...
[04:13:20] Them attributes go a long ass way, bro. so But I can't watch one person go through phase 1 real quick I beat it I literally
[04:13:59] beat it
[04:14:09] are the DLCc weapons even good
[04:15:15] they're great, yes. so oh my gosh. Who else is anybody else doing a marathon? Wait, Ludwig?
[04:15:16] Yo, I swear to God.
[04:15:17] Yo, I'm not gonna lie.
[04:15:19] Chat, me and Ludwig might have to collab on something, bro.
[04:15:20] I think we're the only dumbasses
[04:15:21] to be doing shit like this.
[04:15:25] Yo!
[04:15:27] I'm not gonna lie
[04:15:53] Bro Bro, I swear bro. Hold on, hold on, hold on. I don't know.
[04:15:53] What part is he on?
[04:16:08] Okay. Wait, he's on the same one I'm on? How much time?
[04:16:09] Come on baby.
[04:16:10] Uh oh.
[04:16:11] I can't watch. Fuck. Come on, baby.
[04:16:16] I can't watch. Fuck!
[04:16:24] I can't watch. Wait hold on, I gotta wait for him to die. Hold on, I have to wait, I have to wait, I have to watch. Wait, hold on. I got away from the guy.
[04:16:24] Hold on.
[04:16:25] I have to wait.
[04:16:26] I have to wait.
[04:16:27] I have to wait.
[04:16:28] I have to wait.
[04:16:29] I have to wait.
[04:16:30] I know.
[04:16:31] I know.
[04:16:32] You see?
[04:16:33] I'm playing Fearless.
[04:16:34] That's W-Fearless. That's W-Fearless. That's W, you know?
[04:16:37] That's W-Fearless.
[04:16:38] I want to see what time he's at.
[04:16:44] Oh my gosh, 55 hours.
[04:16:46] OH MY G-
[04:16:48] 829!
[04:16:49] Wait so I'm technically doing better than him?
[04:16:53] Am I?!
[04:17:08] No...I didn't guys here what up Kai how you living you dying, are you hurting? I'm hurting.
[04:17:12] I'm hurting right now. I'm hurting emotionally this is tough on me
[04:17:16] I want it to be done.
[04:17:19] Bad.
[04:17:27] I'm hurting bad lot. Lot is bad, bro
[04:17:30] Let me get actually bad
[04:17:36] It's bad, bro
[04:17:40] Hey It's bad, bro. Hey... I will say though
[04:17:43] I like the way Kai has been playing the run
[04:17:47] It is actually part of the reason because I did the Elden Ring in one sitting two years ago.
[04:17:51] Chey you remember that.
[04:17:52] But i cheese the fuck out of it.
[04:17:54] I use summons...
[04:17:55] I didn't just summon like the mimic tier which like whatever
[04:17:59] I summon humans
[04:18:02] Ice jump dudes that to fight for me. I was like a fucking royal king
[04:18:08] So part of the reason, I'm doing no summons this time is
[04:18:13] It's cuz the way Kai did it because I was fun to watch
[04:18:17] And it felt more rewarding at the end
[04:18:23] Yo, he's actually locked in!
[04:18:25] This is a good stream. Look at the markers
[04:18:27] on his tab, Jack.
[04:18:29] Best attempt... He's tough!
[04:18:33] Yo, no his...
[04:18:37] He has the best attempt
[04:18:43] Matter of fact, we better go attempt for a channel again.
[04:18:46] Matter of fact, like about everybody going.
[04:18:49] You better go attempt for a time.
[04:18:52] I'm gonna ask you war pick. Go to Ashen War pick, wait hold on.
[04:18:55] Go to Ashen War and pick something cool and change an increase in damage for jump L1.
[04:19:03] Wait stay keep it there keep it there go to ash of war
[04:19:13] i can't see
[04:19:20] Please it's not it
[04:19:27] Oh Oh!
[04:19:35] Then... A cult. then cults and then what I'll call in and oh yeah it gives me the boost?
[04:19:50] Plus 20 damage all around.
[04:19:51] Plus 20 damage all around.
[04:20:02] Oh my god, this is so... Oh, only on Jump L1.
[04:20:04] Is it only on Jump L1?
[04:20:11] On L1, okay.
[04:20:12] On L1 on that song again.
[04:20:18] Wait!
[04:20:22] Do I automatically have it? Oh, I automatically have it.
[04:20:28] I was just scared you don't activate it Why do you think I thought you activate rivers of blood this whole time? so so so Oh shit! Hey, what level is Ludwig?
[04:21:37] Somebody said that.
[04:21:39] Hey, that nigga... Nah he's definitely like- He's gotta be lower than you.
[04:21:48] 156?
[04:21:49] I'm 173 chat.
[04:21:50] This shit the fuck is going on? shit so so so I'm not sure if you can see the oh Gosh!
[04:23:01] I'm a dumbass, I don't fuck with dumbasses.
[04:23:04] Nobody, I'm fucking useless!
[04:23:07] I'm useless bro, I'm fucking useless bro.
[04:23:10] I'm useless bro, I'm useless bro i'm useless bro i'm useless bro i'm useless bro
[04:23:14] with the the blade like do y'all see a damage difference in the blade
[04:23:19] well plus 20? Like... so I'm not sure if you can see the so so I'm not sure if this is the best way to do it, but I think you can get a lot of points for that.
[04:24:16] You can also use your so Yo! I said a heal, but chat, let me tell you something right.
[04:24:50] Hygaline, I feel better bro. Cause I know that Ludwig is so good at the same part.
[04:24:55] I thought I was the only nigga that... I thought I was the only one that kept dying
[04:24:57] so early!
[04:24:59] This is common!
[04:25:19] That niggas is dying it's early check? That's a cool vehicle.
[04:26:14] Almost there! How do you guard that tool? so I'm not sure if you can see the What the fuck man? You're not even trying?
[04:26:15] Hey bitch.
[04:26:26] Oh my god, I hate this nigga. You fucking loser. You fucking loser. Hey bitch it's easier said than done.
[04:26:30] How about you having a fucking game?
[04:26:32] I hate you bitch, I hate your username
[04:26:33] Yo ban that nigga!
[04:26:34] Fuck him, fuck everything he stands for
[04:26:36] I fucking hate him
[04:26:38] Don't-I don't ever want to see you
[04:26:39] In my fucking chat again boy
[04:26:40] You understand me boy? Huh?
[04:26:43] I don't ever wanna see you in my fucking chat again.
[04:26:46] Banned him!
[04:26:48] You're fucking ugly!
[04:26:50] Whatever profile picture you got of your fucking shit...
[04:26:52] ...I hate it, boy!
[04:26:54] Fuck you, fuck you boy!
[04:26:55] Yeah!
[04:26:56] How'd that feel?
[04:26:57] Oh, you didn't like it right?
[04:26:59] I know.
[04:27:00] I know you didn't like it.
[04:27:01] You wanna know why?
[04:27:02] Cause you a bitch!
[04:27:03] You know who else a bitch?
[04:27:04] You! Your soul, your who else a bitch? You.
[04:27:06] Your soul, your insides.
[04:27:07] I hate it.
[04:27:07] Your house.
[04:27:08] I hate it.
[04:27:10] The way you lay your fucking head at.
[04:27:11] I hate it.
[04:27:13] How dare you say hey.
[04:27:14] You're not even trying. You just really typed it on your fucking PC, iPad or laptop?
[04:27:18] Huh?
[04:27:19] FUCK YOU! I'm going to try and get the so so so so Oh, I'm at three shots!
[04:28:27] Busy Franks. Sonny send me a picture to my Twitter. Or my phone.. It's going to take a minute.
[04:29:03] I'm making sure you didn't get him.
[04:29:07] Oh, it was going to take a...oh okay, okay, okay
[04:30:28] I think you got the Oh yeah, cause we need a lot. so so so so Are you ready to see what is going on?
[04:30:40] Are you aware to say what the game is still running on its own. It's a bit of an understatement to say that this was originally meant for the game itself.
[04:30:45] But yeah, we're back in the game. so I'm going to try this is the best way to do it, but I think that's a good idea.
[04:31:17] I don't know what to say about this one... so I almost fell bro so so I'm not sure if this is the best way to do it, but I think you can just go with what's in your inventory.
[04:32:21] I don't know why they're doing that here... so I'm not sure if you can see it, but the Oh my gosh, bro. It's not looking good, bruv. uh so so so so so so so I'm not sure if you can see the so so so so I'm not sure if you can see the Did I use my rune in the beginning?
[04:36:21] I'm gonna fuck, I'ma use my rune.
[04:36:24] Hey hey hey hey hey!
[04:36:26] Yeah I'll give a fuck.
[04:36:27] I'ma use that motherfucker rune
[04:36:29] in the fucking beginning every fucking time.
[04:36:32] Every fucking ti-
[04:36:33] I did it?! I'm going to go back and do this. so I'm not sure if you can see the Oh my god!
[04:37:36] These pump fakes are ass.
[04:37:39] These pump fakes are so fucking asshole.
[04:37:42] These pump fakes are asshole. this. I'm sad right now, chat.
[04:38:17] I said I'm actually sad.
[04:38:25] Wait!
[04:38:32] Wait a second.
[04:38:36] Ruby Rose and Drisky broke up? I got it, I got it.
[04:39:04] Um... Okay, I'm single guys.
[04:39:06] Oh, I'm in love with that.
[04:39:08] Favorite love song um okay
[04:39:27] well that was fast this is a publicity stunt.
[04:39:32] He hired Ruby to play as his girlfriend
[04:39:34] and increase his appeal with women.
[04:39:36] Y'all can't convince me otherwise.
[04:39:38] Alright, here we go.
[04:39:40] Let me get back down in the ring let me give myself that cardi's jacket I'm gonna blow um I'm loading up the game, hold on so so so.
[04:41:09] .
[04:41:14] . so so so so Thank you. Well, let me have a rule and a saw in the port now, could I?
[04:42:17] I'll find up a ladder with a hammer and nail now nailed.
[04:42:23] Well, do what so hard to build a little house together
[04:42:27] in the snow or the rain
[04:42:30] or the ice cold wind whenever
[04:42:32] no matter
[04:42:35] what
[04:42:37] the weather
[04:42:38] we're together He's gonna get him. so so so so Help!
[04:43:52] Help!
[04:43:56] Help!
[04:43:58] Help, help, help.
[04:44:00] Help!
[04:44:07] Help bro, help bro...
[04:44:32] Help me please! Yo, Chad.
[04:44:35] How the fuck did SQC beat this, bro?
[04:44:37] There's no... Wait, okay, hold on.
[04:44:39] How much total time did it take him to beat this shit?
[04:44:42] Total time!
[04:44:48] I'm sorry.
[04:44:50] I'm so sorry. I'm sorry. No, not two days because he get a bang on quick, man. so so so uh so so so so so so so oh my gosh bro, this nigga's overpowered.
[04:47:27] I won't be surprised if he gets nerfed in the future i won't be surprised bro damn twin shut the up so I'm going to have to do this one. so I'm not sure if you can see the I Might have been given Tommy He's not even giving Tom a heel bro.
[04:48:50] What's at the picture? what's up Oh my gosh.. Do we need a new weapon?
[04:49:42] Like, what do we need, bro?
[04:49:43] Like, what's our problem, dude?
[04:49:52] What the fuck? Oh wait, hold on.
[04:50:25] Sonny, you sent me a picture on the wall. Hold on, Chas. okay
[04:50:31] all right sunny let me see this photo chat will sunny well well chat will sunny um
[04:50:39] yeah well sonny uh come and say the day again yes or no let's see. Oh, where the fuck? Oh my gosh, yo I think I'm drunk.
[04:51:29] Why am I not going to Sonny's picture bro?
[04:51:33] If you don't have the grace or a circuit There's a frag here.
[04:51:37] Hold on, what?
[04:51:48] I definitely got that frag, right?
[04:51:49] Check.
[04:51:55] Okay.
[04:52:09] And then... the other photo they sent was good armor for you. So to start from here, and you gotta rotate...
[04:52:11] ...to here. What am I looking at?
[04:52:26] Oh, chat.
[04:52:29] Sometimes in life you fail and then you feel like Oh, chat.
[04:52:33] Sometimes in life you fail and then you fail again
[04:52:35] And then you fail again
[04:52:37] And then you fail again
[04:52:39] And then you fail again
[04:52:41] And then you fail again. And again, and... oh fuck.
[04:52:49] Ah, GG's Oh, jeez. so All right chat, vamonos. If he beats it at 60-60, so to solve.
[04:53:30] Trust me bro I will hop off the 5th once I'm at 65 and then I'll hop off the fifth once I'm at 665 and I'm gonna hop over there again. Once it might see
[04:53:37] Trust me got nothing to worry about
[04:53:45] Trust me, gang.
[04:53:48] I don't need no evil shit on my side,
[04:53:49] gang. I don't need none of that evil shit.
[04:53:51] Y'all saw I got that with that 4-4-4, right?
[04:53:53] Yeah! Y'all saw that, right? Come on now. come on now. Come on out come on out so we do
[04:54:00] God he's good
[04:54:11] Oh oh what do you do oh when these sound good
[04:54:52] good arm right here so i'm hungry so Phantom, how the fuck did you hear that bro?
[04:54:54] Yo phantom.
[04:54:57] Yo phantom i'm struggling bro
[04:55:15] i'm on the last boss bro and i'm struggling Oh Yes, honey yes study cook plus 10 damage on that fucking jump. Oh, yeah we need that
[04:55:30] All right back back to being depressed.
[04:55:38] Back to being fucking depressed bro.
[04:55:43] Get some Oxtail? BUMBA CLAT! The man just cooked my ewe-
[04:55:47] Yo the man said get some OXTAIL dog
[04:55:49] Oh wait I got my breakfast from this morning
[04:58:33] Silly me! No fool for this! no food for years Help me please. Please. Oh, bro. Oh my, I wish I had an extra toast slice. um um This depressing as fuck. so so. This is bad.
[04:58:41] You know how long I've been... I don't fart.
[04:58:46] I don't fart!
[04:58:52] See what else, look at what else I got. Oat milk Oh, milk cookie. Oh no cookie.
[04:59:07] Cake, cake
[04:59:17] You are my sunshine.
[04:59:27] My only sunshine.
[05:00:12] Who laid me down? Let me die be When times are blue My happy sunshine.
[05:00:31] You make me happy I'm gonna go I get up in this game, I'm beating my shit. I am going to be honest bro
[05:00:43] I'm joking! I haven't done that in like years, man.
[05:00:49] I haven't done that in years! so so so so Yo!
[05:01:49] Yo, like how the fuck
[05:01:53] is he sucking me in?
[05:01:56] First play. so I'm going to have to do this again. Yo!
[05:02:36] Bro, like what the fuck? so so so so so so so Come on, bro.
[05:04:11] Come on, bro.
[05:04:12] I understand you so big and bad but come on, bro. I, I, I, we understand you so big and bad.
[05:04:15] But come on, bro.
[05:04:16] Now you wasting my time.
[05:04:19] Now you wasting my time.
[05:04:20] Now you wasting my time.
[05:04:22] Yep, yes, you are.
[05:04:23] No, no, yes, you are no no yes you are
[05:04:25] yes you are you're preventing me from moving on
[05:04:30] yes yes you fucking are you're preventing
[05:04:34] me from moving fucking on. so I knew it, I knew it! so Oh, no!
[05:05:27] He should not be able to
[05:05:29] Heavy attack like that
[05:05:31] Then instantly turn around with a two hit combo
[05:05:33] That is impossible
[05:05:35] Yo Elden Ring
[05:05:36] Elden Ring he should not be able To do Ring? He should not be able to do that nigga!
[05:05:41] He should not be able to do that. Who the fuckin' damn is this nigga?
[05:05:44] I'm gonna walk into their fucking office and delete this file from the fucking DLC
[05:05:48] I'M NOT PLAYING NO FUCKING GAMES NIGGA! I'm not playing no fucking games, nigga!
[05:06:33] Imma delete the file bro! so This is why we gotta appreciate the games that are easy bro this is why we gotta appreciate the games that aren't easy that are that are that are like you know
[05:06:39] you don't like like this is what i'm gonna like if i go to
[05:06:41] if i go out if If I hop on GTA my nigga
[05:06:46] I'm gonna kill every cop on that bitch. Easy nigga
[05:06:49] EASY so so so so I'm not sure if this is the best way to do it, but I think you can just go with what's in your inventory.
[05:07:43] I don't know why they're doing that here... so so I'm not sure if you can see the so so Thanks for watching! I fly with the stars in the sky. so so so I'm sorry. so Come on, bro. Come on!
[05:10:06] Come on!
[05:10:08] Come on!
[05:11:12] Come on! so so so I'm not doing no damage, bro. No, I gotta see somebody else struggle.
[05:11:17] I gotta see somebody else struggle.
[05:11:21] I gotta see somebody else struggle.
[05:11:22] It,
[05:11:22] it,
[05:11:24] it enlightens me.
[05:11:26] It enlightens me.
[05:11:29] Me seeing somebody struggle enlightens me
[05:11:30] crazy. What do you mean? Me seeing somebody struggle enlightens me. Crazy!
[05:11:34] What do you think I understand?
[05:11:36] It's gonna enlighten me bro
[05:11:40] It's gonna fucking enlighten me, bro.
[05:11:43] I can't fucking give up, my nigga.
[05:11:46] Fuck outta here, bro.
[05:12:02] Oh my gosh! You know what's bad when a nigga leave.
[05:12:04] He's hard like to least go.
[05:12:06] You know what's bad when a nigga leave!
[05:12:10] He gotta go stack.
[05:12:18] I thought you know what get back bro that's how you know it's real beef that's why you know was real beef game JC why is this here JT's in it what do you say he He is.
[05:12:38] He is!
[05:12:40] Yo, Jinxy!
[05:12:44] Why's he so delayed? Yo Jinxy!
[05:12:47] Why is he so delayed?
[05:12:49] He needs to um...
[05:12:51] Replay fucking...
[05:12:53] He needs to replay the game.
[05:12:55] I have a lot of jinxys don't hop back on the game bro.
[05:12:57] No, no, no, no. Jinxys don't hop back on the game though
[05:14:00] no jc do not hop back on the game ground. so so so I'm not going to let you get away with this. NIT! Did he just back to ba- yo, did he just back to ba-
[05:14:10] Bro, did he just back to back? Bro, did he just back-to-back?
[05:14:13] Bro, did he just back to back gravity pull?
[05:14:17] Did he just back to back fucking gravity pull?! Did he just back to back fucking gravity pull on me? so so so so so so so I'm not sure if you can see the so so so so so so so Wait! Wait!
[05:17:24] Wait, be fucking patient.
[05:17:28] WAIT!
[05:17:30] Wait, be fucking patient you fuckin...
[05:17:32] Yo shut the fuck up bro!
[05:17:35] Be patient!
[05:20:15] AHHHHHH so I'm not sure if you can see the so so so so so so so so so That wasn't bad. I'm not going to let you get away with this. I'll be right back. Yo! Notice how gay he was? yo notice how im getting hit by all his slow attacks bro notice how i'm getting my all
[05:20:33] his slow attacks bro so so so so so so Thank you for watching. It's not even worth it. I'm not even gonna smash this, bro.
[05:22:07] Yeah, it's not worth it. It's not worth it.
[05:22:09] It's not... It's NOT worth it it's not worth it it's not it's not worth it
[05:22:14] it's not uh so It's fucking worth it.
[05:22:52] Fucking, it's always worth it.
[05:22:55] It's always fucking worth it.
[05:23:00] It's always worth it.
[05:23:03] I'm a bright sign!
[05:23:35] A really bright sign! I'm gonna end up breaking sign chat. Let me chill.
[05:23:36] Let me chill. No. Let me chill, let me chill bro. Oh my God!
[05:24:11] My phone don't want to work. But every time I chill,
[05:24:14] I go...I'm taking like a TikTok detox
[05:24:17] just going on TikToksck just just trying to do you know Ancient the kitchen? Who is this, he still watching me?
[05:24:43] Wait! Big K- I just watched somebody on TikTok.
[05:24:46] Ancient the Kitchen? Who is this, he's still watching me?
[05:24:52] Wait! Big K- I just watched somebody on TikTok.
[05:24:54] Bro! You're watching me bruh?!
[05:24:56] Have you been watching this whole time?
[05:24:58] He said I can't be with you.
[05:25:00] I just watched somebody on off. Not again.
[05:25:02] You watching me, bro?
[05:25:03] Not again.
[05:25:04] How you been watching this whole time?
[05:25:05] Maybe you seen me yesterday.
[05:25:07] Yo now he's tough!
[05:25:09] You watching me, bro?
[05:25:11] Not again.
[05:25:12] How you been watching this whole time? Oh yeah yo that's because of how you said it. Oh, yeah.
[05:25:14] Yo, that's because you said our headsets shake.
[05:25:16] Damn!
[05:25:18] I gotta do this shit for her!
[05:25:30] Damn! AHHHHHH! I saw the motivation in that needed, man.
[05:26:19] Oh... I need information on needed, man. so so He stopped me. He's stopping me, chat. Do you understand what makes this worse?
[05:26:21] It's like a non-realistic character is stopping you from thriving in life.
[05:26:31] Are you understanding?
[05:26:50] He's... uh Bounce! Bounce!
[05:26:55] Bounce! BELTS! BELTS! so It's cool bro
[05:27:30] Come on come on Yo get them frags bro please!
[05:27:36] I know that shit gonna be hard as fuck to do though, alright Cap? I don't...
[05:27:41] I know what it is.
[05:28:05] ... so I'm not sure if this is the right way to do it, but I think that's a good idea.
[05:28:28] I don't know what he wants me to do with him, so let's just go for it. This is not cool bro. I feel like, I feel useless. uh so so I'm not sure if this is the best way to do it, but I think that's a good idea.
[05:29:14] I don't know what he wants me to do with him, so let's just go for it. so so I'm not sure if you can see the so Oh.
[05:30:11] This is not right for the community, This is not good for the community.
[05:30:12] It's not right. It's not right. so ah I'm not sure if you can see the so so so so oh oh so so I'm not sure if you can see the so so so so so so so so Gang!
[05:33:58] Gang!
[05:34:02] Gang! This nigga had...
[05:34:07] Gang, let me tell you what this nigga had gang.
[05:34:10] Gang this nigga had golden hair coming out from his armpits my nigga.
[05:34:52] Do you understand that? I need a detox bro So it's pissing me off bro.
[05:35:15] See I'm getting pissed right now so
[05:35:40] this piss me off like what do I need to do bro? dreams
[05:35:43] hey what's like ch? What do I do bro?
[05:36:05] I'm trying not to stress, bro. Oh, back God. Back back back back back! No no no no no no no! Get back into it get back into it!
[05:36:09] Back back back!
[05:36:12] Get back into it now. to it DOI!
[05:36:30] You're lying.
[05:36:30] You're lying.
[05:36:31] You're lying.
[05:36:32] You're lying.
[05:36:33] You're lying.
[05:36:34] You're fucking lying.
[05:36:36] You're lying. You're lying. You're lying. You're lying, you're fucking lying. You're lying, you're lying, you're lying. You're lying, you're lying dude.
[05:36:38] Dude you're lying, dude you're fucking lying.
[05:36:40] Dude your lying is fucked.
[05:36:42] Dude you're lying.
[05:36:44] Dude you're lying. Dude you're lying. Do your line. Do your line. Do your line.
[05:36:50] Do your line.
[05:36:53] Oh my God! New Elden Lord of Tell, baby!
[05:37:06] That's the three times um Thank you for the 20 gifted decided. Thank you for the 10 gifted...
[05:37:30] Grammar!
[05:37:33] Dude, my heart's still fucking racing.
[05:37:37] I can taste my fucking heart.
[05:37:41] Thank you for the membership, NeutralNeutralYo!
[05:37:44] Thank everyone for watching!
[05:37:46] Holy shit thank everyone for watching!
[05:37:49] My god that was so fucking long! Holy shit, thank you everyone for watching.
[05:37:52] My god that was so fucking long! That was SO long!
[05:37:54] THAT SUCKS!
[05:37:56] That boss FUCKING SUCKS!
[05:37:59] Feels great to beat him?
[05:38:02] I'm never fighting him again ever
[05:38:04] I'm gonna watch a hundred I promise you 100 videos of different ways people killed Radon
[05:38:10] I'm gonna watch, I'm gonna watch I'm gonna like
[05:38:12] revel in it this is my new TV every night
[05:38:15] of watching people murder that
[05:38:17] motherfucker pedophile by the way
[05:38:19] certified pedoph's not me saying that that's the lord oh he got charmed into being
[05:38:27] a pedophile okay let's see how that one holds up in Portland on fucking
[05:38:33] great thing you can get the Dave
[05:38:35] Robinson appreciate your man Patrick
[05:38:38] thank you 20 gifted think of the five
[05:38:40] New Zealand dollars you did it baby I
[05:38:42] did it baby I did it I did
[05:38:44] it
[05:38:46] bullshit
[05:38:49] not you know what
[05:38:52] so happy that i did it no summon, no magic
[05:38:57] Cause i cheesed the f*** out of my first Elden Ring run
[05:39:01] My first ever Elden Ring run two years ago
[05:39:03] I did in one setting when the game came out.
[05:39:04] Jesus shit!
[05:39:05] I summoned Mimic Tears...
[05:39:07] I summoned humans!
[05:39:09] If you watch me there is a moment where I summon 2 people to fight the Elden Beast, and I watched them!
[05:39:17] I literally say like a fucking commander.
[05:39:20] I'm like Bill Belichick go off Tom Brady
[05:39:24] The only reason I did it...
[05:39:27] Shout out Kai because the only reason I did it, shout out Kai. Because the only reason I did it is because I watched Kai's stream on his Elden Ring run and he did it real
[05:39:33] And a lot of people fucking made fun of him for being dog shit
[05:39:35] And to be fair he was dog shit when he started
[05:39:36] it got so good i'm just trying and persevering
[05:39:42] and i did it i did it thank you kai
[05:39:48] i'm excited to watch him beat it up. Oh my god!
[05:39:50] I'm gonna go to every streamer's chat and tell them how
[05:39:52] to beat the bot- I'm going to backseat everybody!
[05:39:54] Oh, Elden Ring category on Twitch
[05:39:56] Watch the fuck out!
[05:39:58] Hey, uh... have you considered getting like, um... maybe... I don't know?
[05:40:02] Um, like a Holy Brave to deal with holy damage?
[05:40:05] Hmm, just an idea.
[05:40:08] I dunno, just throwing something out there. Have you tried not dying?
[05:40:22] Oh Oh Poor guy
[05:40:26] I started before him though
[05:40:28] I started before him 2 hours before him though i started before him i started before
[05:40:30] him two hours before him it's time difference bro it's time
[05:40:34] difference
[05:40:37] and you beat a couple bosses I didn't beat Ooh, ooh, ooh
[05:40:55] Everybody's laughing in my mind
[05:41:03] Rumors spreading by I don't know what you just said. You're not the one who's gonna get it now, okay? Stop your driver!
[05:41:06] Stop for 57 hours.
[05:41:08] Do you do what you did when you did with me?
[05:41:12] Now see, love,
[05:41:13] you're the way I get it.
[05:41:15] Don't forget all the pain
[05:41:17] that came into me
[05:41:19] cause baby, I didn't
[05:41:21] There should be me holding your hand honestly I'm so sad, this should be me
[05:41:37] Honestly Probably one of the best video games all time
[05:41:41] I mean easily but i'm saying
[05:41:43] I think it is the, I think it is the best.
[05:41:46] I think it is the best.
[05:41:52] With DLCs 100?
[05:41:54] Oh, get the fucking merch then thank you to 20 gifted bad boy no
[05:41:58] thing is 699 Canadian dollars Alex Devin Sims think very much of membership
[05:42:03] evil G minion thank you very much to the 5Botsman. Tyler Postalone, that's a fire name. Cool Kid. Radon is Mikolas brotherhood. I can't do this no more bro. I'm gonna kill you! Every time I just die.
[05:42:41] Every time man!
[05:42:44] Every time bro! update sub count bro I don't want to hear this no more.
[05:43:03] I don't want to see the main screen no more.
[05:43:09] I don't want to see the main screen no more i don't want to bro i don't i don't i'm so i don't
[05:43:14] i don't, bro.
[05:43:23] I fucking don't, bro.
[05:43:25] I fucking don't, my nigga.
[05:43:27] I don't.
[05:43:28] What about that?
[05:43:29] I'm getting mad, bro.
[05:43:30] I'm going to do something that i'm gonna regret game
[05:43:32] i'm gonna uppercut the fight i'm gonna jump yo i'ma beat them i'mma beat my
[05:43:41] all right guys welcome to the elder ring DLC I'm excited hey last time you were
[05:43:47] here we did a hundred and sixty eight hours millennia be got done and bro here we go it's time out of the ring DLC last
[05:43:59] time he was here it took a hundred thanks what's's that? Like seven days.
[05:44:03] It took seven days.
[05:44:05] This time they just came up with the DLC
[05:44:07] We about to get into this
[05:44:08] we have to beat this bro
[05:44:10] We have to
[05:44:11] So let's get right into it man
[05:44:12] I'm excited bro
[05:44:15] Man like i'm actually excited I ain't gonna cap. No I'm actually excited so
[05:44:17] Let's go back to the DLC
[05:44:21] I don't know what type of bosses they have on here
[05:44:23] So we abouta see right now and and amen i'm excited you feel me
[05:44:27] so let's go ahead and see it Oh, this is crazy!
[05:44:51] Okay.
[05:44:55] Okay, alright! Okay!
[05:44:59] Okay, alright! Oh wow!
[05:45:03] Okay!
[05:45:19] ... Oh wow, he's good! He's good! Okay!
[05:45:27] ... so All right! Alright, alright, okay! all right all right okay all right you see I like what they did here
[05:46:06] no but I'm not gonna lie.
[05:46:12] This isn't too bad, you know?
[05:46:14] And I feel like we'll be able to do
[05:46:16] this together, you know? So
[05:46:18] let's see how it goes. Let's do it again. That was our
[05:46:20] first attempt. Let's go ahead and see how
[05:46:21] it is one more time
[05:46:23] Let me see how we get into this right here
[05:46:27] Wow man!
[05:46:44] Oh my god Wow!
[05:46:52] WOW! Wow! Wow!
[05:47:10] Wow!
[05:47:20] Alright!
[05:47:24] BANG! so so Nah, bro.
[05:48:01] I want another one to struggle with me, bro.
[05:48:06] He's free!
[05:48:07] Like, do you understand? understand beating this game is like
[05:48:11] You're able to go outside and do shit
[05:48:15] You are able to go outside
[05:48:17] And continue the life that you let like
[05:48:19] you live you're able to continue the life that
[05:48:22] you lived i need to stop complaining and i needed a fucking beat bro stop
[05:48:26] like kyle i don't like how you complain too much
[05:48:28] this ass like stop complaining bro.
[05:48:31] That ass.
[05:48:37] Look i'm dick riding
[05:48:39] I got his gear that he just had on.
[05:48:40] Look, Dick Rider.
[05:48:41] Dick Rider. Bum ass outfit bro, get this shit the fuck off me my nigga. so so I'm not sure if you can see the so so so so so so I'm not sure if you can see the so so so so so i promise you a thousand year voyage guided by compassion so I'm going to go back and get the car. Did this bitch just whisper in my ear, man?
[05:52:29] Did this bitch just whisper in my fucking ear, man?
[05:52:36] Did this bitch just raise me the fuck up though
[05:52:48] How am I supposed to hit that nigga, chat? Be honest.
[05:53:20] How am I supposed to hit that nigga? Sonny, what you say you have for me bro? Bro! Bro, that's the longest I lasted in a... Chad, that's the longest
[05:53:21] I ever lasted
[05:53:22] in the second phase, bro.. I'm
[05:53:43] city said what That's the fucking... what did you say?
[05:54:07] Bro, this shit is crazy bro.
[05:54:10] Yo! Headphones! Headphones! Headphones!
[05:54:12] I heard them from here.
[05:54:16] Chris are you there? My headphone is about to die.
[05:54:20] Yeah I can't stop I have to go back to bed
[05:54:38] wait hold on sonny what'd you say you had for me Hey!
[05:54:52] Best...
[05:55:04] defensive talisman. Where? best defensive talesman where well where picture
[05:55:09] okay
[05:55:22] wait but what do i replace chad What? What tells me what i'm a place Oh
[05:55:43] This right this this one, this is my defensive one, right? Keep that.
[05:55:52] Do you know me taking out the turtle? I will not be able to survive my next turn.
[05:55:56] Oof! to survive, my little friend.
[05:56:05] It's not me taking out the turtle? Gang, I need that.
[05:56:12] I want that.
[05:56:13] Let me try it one time real quick.
[05:56:17] Hold on.
[05:56:18] Hold on, hold on. Let me try it one more time.
[05:56:20] Let me see how it is!
[05:56:24] What should I add?
[05:56:28] I'm going to just add the health. What should I add?
[05:56:31] I'm going to just add the health.
[05:56:34] If I set up the grace, would it refill?
[05:56:36] Shut up!
[05:56:36] If I set up the grace, would it refill right there?
[05:56:39] It would. right there it would
[05:56:44] let me see how my life is without the
[05:56:45] turn bro so so so It's too slow.
[05:57:37] That's too slow!
[05:57:43] I ain't gonna lie, when it got down to low and it's taking that... Whoa, that's too slow, bro.
[05:58:17] Hold on, let me see the other one So let me go ahead and see it real quick Hold on
[05:58:17] I might as well remove the claw bro
[05:58:24] I feel like I'm a lion too much on manner. For Phase 2? Not for Phase 1?! Wait, am I missing a grace?
[05:59:15] Whoa! I think i'm missing a grace right here. so Wait, I'm missing a grace! wait a better turtle tales man wait is it better one?
[06:00:10] I'm missing a grace.
[06:00:28] How do Ciao again! I gotta... Hey, you need to what?
[06:00:37] You need to gesture in Bonnie Village. How do that?
[06:00:41] You need to emote in Bonnie Village.
[06:00:43] How did I do that? Where's Bonnie Village?
[06:00:45] Bonnie Village mo and bonnie village how do i do that where's bonnie village bonnie village
[06:00:51] where's bonnie village Southware. software so
[06:01:26] nevis is bonnie's village Oh my gosh, bro.
[06:01:59] Where do I go now? so so. Yeah, yeah that
[06:03:24] This way? so so who's that? so I don't know where the fuck this shit is at. so chat bro
[06:04:15] like we gotta get this nigga
[06:04:17] bro he disrespecting us bro
[06:04:20] he disrespectin niggas bro
[06:04:31] is it here? What?!
[06:05:35] Bro, where am I going bro? so so so Someone go up here. Fr, please?
[06:08:07] Bro I'm telling you there's a lot more out there that I just don't know bro. This game is too advanced. Now the picture. Oh. so so this game is too advanced chat oh not you hey hey so He's trying to make another debut chat What happened? Frag? is So swap...
[06:08:28] Wait a minute.
[06:08:33] So, so swap what?
[06:08:42] What I'm like... Am I invincible?
[06:08:51] From holy damage? Okay. Now let's get the best turtle.
[06:09:00] Let's get the best turtle and can we get some frags?
[06:09:03] Oh my gosh! I just need two more uh i want to find a whole bunch of frags bro There has to be some in this area, right chat? go surely bro oh I'm going to try and get the door open. Wait.
[06:10:04] Wait. Oh
[06:10:23] So no, I know la check this is basically easy it's not these against but it has to be something up there, right? Right?!
[06:10:27] Oh, there's a Grace
[06:10:29] right here!
[06:10:49] ... Yo, my headphone is... Did he bring my headphones? Who's to put him in a headphone jack if there be no headphones!
[06:10:59] Ah, fuck.
[06:11:01] He's by the door? so.. Yo, um...
[06:11:43] Also? Chat. We still have the opportunity to increase
[06:11:48] the heal amount on a flask right?
[06:11:54] Hello? Yeah.
[06:12:03] Oh shit, I have it!... so Nah, this nigga work with the developers bro.
[06:12:23] Nah he works with the developers of Elderling, my nigga. Yo, how much money do you think Eldering is worth? worth all right what about FromSoft?
[06:13:03] Like the community... like the...
[06:13:05] What about FromSoft?
[06:13:11] Billions, huh?
[06:13:14] Yeah. so so so so so You see? I need to do something.
[06:14:22] See, come on. Come on bro. or something and it was something see
[06:14:29] everybody eyes peeled eyes peel look for some shit
[06:14:52] Oh this doesn't feel good.
[06:15:03] It doesn't feel right. something goes where chat
[06:15:21] I'm I imagine it was 60...
[06:15:25] 60 frags?
[06:16:26] Not this one. I know this birds one though. Thanks for watching! so I'm not sure if this is the best way to do it, but I think that's a good idea.
[06:18:34] I don't know what you're talking about. so so so so so so so so I'm not going to let you hit me. so Yes! No! so so so so Oh my gosh!
[06:19:39] That thing got frags?
[06:19:43] Yo search that up, search his name up.
[06:19:45] Did he have frags? I think he has frags.
[06:19:52] I don't know, I don't think so.
[06:25:52] Oh! he might not bro so so so I'm not locked in. so so so so so so so so so so so I don't got a jump claw no more, right? so so so so so so so so so so so so so so so Right. Frags? Anything?
[06:25:57] Gravitational missile.
[06:26:01] No frags!
[06:26:07] KSO raid? Did KSO beat it?
[06:26:32] Was KSO in Outer Ring today? did cancel beat it it was kids on outer ring today nothing bro Wait, did he raid me for real?
[06:26:35] I don't think so.
[06:26:38] I just came from the shack Wait Wait.
[06:26:52] Sonny, can you... sunny cute sunny did they mean mods did they made me for real. Um...
[06:27:22] Wait, did he for real? I mean regardless if you didn't not
[06:27:26] shout out to y'all man thank you appreciate it
[06:27:32] don't make me mention that okay check if you have the bottom grace first
[06:27:37] and not go to top grace.
[06:27:40] Check if you have the bottom grace first
[06:27:41] and not go to top grace.
[06:27:44] Wait, let me explore this real quick.
[06:27:45] Hold on, hold on, hold on.
[06:27:48] Look, look.
[06:27:48] Grace right here, look.
[06:27:53] See?
[06:27:53] You like that out of me?
[06:27:54] I like how I just stood there and beat that nigga.
[06:27:59] You like that?
[06:28:00] You like that?
[06:28:01] Was that fire?
[06:28:05] Was that fire?
[06:28:09] Oh, my God. Is that a bomb? Oh my god, not these hands.
[06:28:18] Handy?
[06:28:21] Handy, I want a job.
[06:28:28] Nomies no!
[06:28:32] Nomies no, I don't want no fucking hit.
[06:28:41] There's no frags over here chat? Wait! Hold on Sonny. There's no
[06:28:43] Wait hold on is that map with all the frags on it?
[06:28:55] ... Wait, is there nothing here? Just confirm.
[06:28:56] What is it?
[06:29:01] There's nothing here. I
[06:29:08] it Damn! is it is there no fries here here This aimbot gotta stop bro. I'm not sure if you can see this, but the so lonely This shit is like lonely as fuck. Blow, what do you mean blow? I'm low! so Bro, there's no reason...
[06:31:14] Bro, there has to be a reason why this is like the middle.
[06:31:17] Oh, what is he doing?
[06:31:21] Oof! Oof! Oh, what is he doing? Move!
[06:31:24] Wait, what?!
[06:31:28] Wha-
[06:31:30] What the fuck?
[06:31:34] Oh, it's a quest.
[06:31:38] Alright bro!
[06:31:40] Alright next, next! alright bro all right next next okay Okay.
[06:32:10] What am I looking at? Last three all our Franks I'll need that I need the arm um Well, what is this like pathway? Kill it, River.
[06:32:48] You like river?
[06:32:50] Okay, bet.
[06:32:52] And then I go up...
[06:32:54] What am I going up to?
[06:32:56] Where is the water? okay and then i go up what am i going up to what is that what is that what is that what is that
[06:33:03] is that the defense defense so right there right where What the fuck? so Where's this shit gonna be at chat?
[06:34:15] Fuck, fuck, fuck.
[06:34:16] Waterfall, waterfall, waterfall I see see a waterfall. Now where's that? I'm going to try and get a better view of the area. Is it here?
[06:34:50] Is it there?
[06:34:56] This should be hard.
[06:35:03] Okay, hold on. Okay.
[06:35:11] Hold on now!... Wait. wait
[06:35:29] what spot looks like that?
[06:35:32] oh, I definitely got that right
[06:35:35] but...wait Wait.
[06:35:39] One, two, three, four...
[06:35:45] Damn! Oh my god! Damn.
[06:37:46] Isn't that it? so Oh, it's in the waterfall. so This has to be something. What the fuck? so so so so I'm not sure if this is the best way to do it, but I think you can just go with what's in your hand. You don't have to be too careful here, though.
[06:37:51] The only thing that's a good idea.
[06:38:02] I don't know what you're talking about. I'm not sure if this is the right way to do it, but I think that's a good idea. so I'm not sure if you can see the so so I need to shit a car. Jesus
[06:39:18] Let us be something please oh my gosh. No I love which every just we just do a shit Like We just doing shit now.
[06:39:25] Are we locked? What the fuck are we doing bro?
[06:39:27] And we're just cooking side niggas
[06:39:29] now boy
[06:39:36] i guess that gave me a level up right
[06:39:40] yeah what is it going on what's it going on what is it going on? What's it going on?
[06:39:43] Next, next.
[06:39:55] Oh, I'm getting a little bit of uh
[06:40:46] the waterfall is more north than it can in that cave okay Is this one right? I'm not going to bother you, bro. See how easy this mission is.
[06:40:58] Greatly, greatly raises stamina. Greatly raises stamina on recovery speed, that's fine.
[06:41:02] Greatly, Chat Noir!
[06:41:04] Greatly! greatly Wait, is that a car?
[06:41:22] Is that a bus?
[06:42:05] What the fuck? so I think it is. It is, huh? Come on. Hi little fellow, I would never kill you okay? Okay? You beautiful guy.
[06:42:14] We fuck with turtles over here.
[06:42:20] I'm Sunflower's Kato.
[06:42:25] Okay, um... Next! Where we going?
[06:42:31] Where are we headed next? Okay, so...
[06:42:47] Fuck.
[06:42:48] Yeah, I have the...
[06:42:49] I see a frag photos, but...
[06:42:53] Oh, why don't want to...
[06:42:56] Wait! I don't have something.
[06:42:58] Wait, hold on.
[06:43:00] Wait do I?
[06:43:02] How do I get this map? How do I get this map?
[06:43:04] How do I get this map?
[06:43:07] Wait, is it continuing up here?
[06:43:22] Whee! So which place? Which place is easy to go to? Oh yes's this way.
[06:43:34] Because I might be getting some wounds up here, bro.
[06:43:39] Wait a second. God damn!
[06:43:42] There was a lot of this... Damn! I'm so wrong.
[06:43:52] Fuck!
[06:43:56] This one? What's the easiest way to get there? so Radon! Where do I go?
[06:44:35] You are right there. It says this way though
[06:44:39] Okay, it's not this way Oh,.
[06:45:00] Where do I go chat? Yo, how do I get this man?. I'm not go get you.
[06:46:04] Yo, what else can I get ya?
[06:46:06] Fuck my... Yo we need to talk. Yo, what else can I get chat? Fuck. Oh my God.
[06:46:10] Yo, we need shit right now bro like desperately bro.
[06:46:13] We should have started off getting like keeping track of the rooms bro.
[06:46:15] Why don't we keep tracking that shit?
[06:46:16] But we could've kept track. so.. so Hold on, Chad. I'm going to try and get the camera.. What the fuck is this view? This is getting bad.
[06:48:24] Yo, chat this is actually getting bad. Yo, Chad, this is actually getting bad, bro.
[06:48:30] Chad, what do you think I need, bro?
[06:48:34] You think the frags is what's preventing me?
[06:48:37] You think the frags are like, the last key? No, chat look we rather wanna- okay chat you keep saying sleep.
[06:48:54] Do y'all like...
[06:48:56] Like are y'all like do y'all grind my nigga?
[06:48:58] Do you know what bro like
[06:49:03] Bro this is what we do bro
[06:49:17] This is what we do, this is what we do bro! This is what has to be done. If you want the goal to be completed, you have to put in the hours bro.
[06:49:22] At least let's do the dirty work so we don't have to get up and do it tomorrow bro
[06:49:24] that's the whole point of this though.
[06:49:26] We lose sleep
[06:49:29] So we can make a clean sweep, my nigga!
[06:49:37] Hold on, where I'm going chat?
[06:49:41] Yo Sonny you there bro?
[06:49:46] Simba that shit not funny bro.
[06:49:52] Simba, that shit is not funny boy.
[06:50:00] Yo Sonny, you there? You didn't say yo, yo.
[06:50:18] Yo son he just cooked you bro.
[06:50:23] He said yo navigator!
[06:50:31] That nigga just said a nigga to say yo yo GPS yo please game
[06:50:41] no I some of was actually Fnath. I heard him say that too.
[06:50:44] Wait! Y'all going to TwitchCon?
[06:50:50] Are y'all going together?
[06:50:55] Yes! Are y'all going together?
[06:50:59] Yes! I'm gonna go to G-Con, yes.
[06:51:07] So are you going to G-Gon? Wait.
[06:51:09] Wait, hold on.
[06:51:09] Don't put me with my mods!
[06:51:12] Yo, whatever y'all need, y'all let me know
[06:51:13] you heard.
[06:51:15] I'm telling you look i'm telling you
[06:51:20] i don't order i know i know i'm only gonna be for g
[06:51:23] i'm trying to really beat it
[06:51:28] i'm going to like i'm actually on cosplay too chat
[06:51:31] i'm a cosplayer who should i be i want to be somebody from outer ring bro
[06:51:35] who should I be?
[06:51:39] I'm gonna throw his eyes. All right. Ah! so I feel like you gotta go all the way around.
[06:52:24] Oh my gosh, W X-Walling!
[06:52:27] Holy shit.
[06:52:29] Wait no!
[06:52:31] I found it already?
[06:52:37] You're like well I feel like you gotta go all the way around
[06:52:39] Hold on. that's how So what if this whole time I've been exploring, I could have already be in the last boss So we got nothing else, so there's no more frash that you can get, Elias?
[06:53:34] Is it over?
[06:53:43] Is it GG's boat? What's the max amount you can get?
[06:53:47] What's the maximum level for the frags that you could become? You could be 20?
[06:54:04] Is 20 like a huge difference it has to be so. All right, y'all. Knock him.
[06:54:57] Wait! What happened to the defensive sonny what the Oh Well I got it right Oh!
[06:55:21] Wait, I got it right?
[06:55:23] Wait do I have it?
[06:55:26] Oh.
[06:55:29] Ah fuck. I'm going to have to do this again. uh so so so Fuck! Fuck! Come on, come on, come on, come on, come on, come on chat.
[06:56:52] I think right now it's just about studying bro.
[06:56:54] Right now it's just like I have to get closer and closer closer
[06:56:56] to where I feel comfortable
[06:57:05] that's not what flight comes down to it. so so I'm not sure if this is the best way to do it, but I think you can get a lot of points for that.
[06:57:46] I don't know what's going on here... so so I'm not sure if you can see the so so Inside.
[06:58:47] Inside! Scarlet Rot. so so I'm not sure if you can see the so Fuck!
[06:59:51] FUCK! Why does the title say loud 8 HD?
[07:00:08] The tags, nigga?
[07:00:08] Isn't it obvious? so
[07:00:27] jojo Jojo! so so so so I'm talking about you, kid!
[07:01:26] Hey what the fuck? so so so Come on, bro.
[07:02:26] Come on, let's go.
[07:02:28] Come on, bro. I know you want your shine but you're not the cover athlete we beat the
[07:02:32] cover athlete already come on bro just pack it up now just wrap it up wrap it up wrap it up I'm going to if you can see the so so Touch my body, meet me at the door.
[07:03:38] Giving you a kiss, give me some more Wildflower is gonna slow me down. so so Yo, how do you- okay.
[07:04:29] How did you die that double swing?
[07:04:32] HOW?!
[07:04:34] Bro I'm about to smash this bitch. Bro I of spaz in this bitch.
[07:04:36] Bro, I'm out of spaz in this b-
[07:04:38] HOW?
[07:04:44] How do you dodge that double swing? so I'm not sure if you can see the so so Oh, no! Yo! Al, yo bro.
[07:06:01] Alderaan he's damn it.
[07:06:03] His combo is too much, damn it.
[07:06:05] If you need a nigga on the dev...
[07:06:07] If you need somebody on the team let me know.
[07:06:09] I'll be
[07:06:12] a dev i can tell you what to do there's certain things about this that's up so so so so I think I'm being to be with the hits
[07:07:30] i want to start spamming L2, but like bro to break them down fast. That's what I gotta do, bro Oh so so so so Oh, no! Like, how is this even fair bro?
[07:08:36] How is it even fair bro
[07:09:43] how was it even there bro so so so so oh
[07:09:45] please like what? Like... Please?
[07:09:53] Oh! so so I'm honestly getting mad
[07:10:28] This is getting bad
[07:10:32] Like it's weird because like
[07:10:33] How do I explain it
[07:10:35] With Melania
[07:10:35] I figured out her moves
[07:10:37] Let me not even start saying shit Like But Lainey and I figured out her moves.
[07:10:39] Let me not even start saying shit like that, cause bro this ni-
[07:10:42] Like it's just- Oh my fucking god...
[07:10:45] It's just saying that- so so Oh my god. so so so so I'm not going to let you get away with this. I got stuck bro.
[07:12:27] I got fucking stuck bro.
[07:12:29] Oh my...
[07:12:31] AHHHHH! so so so so so so so I'm not sure if this is the best way to do it, but I think that's a good idea.
[07:13:57] I don't know what to say about this one... so oh my god, his attacks are so slow! so I'm going to if you can see the so so so That was easy combos too bro. That was easy combos bro.
[07:15:52] That was easy combos
[07:17:07] That was easy combos bro. so uh so so No, no, no, no, no, no, no. Deathpaint! Deathpain for all we do not!
[07:17:10] He'll swing three times on us!
[07:17:12] He does not...
[07:17:15] He does not swing three times on that, bro.
[07:17:19] He does not swing ti- Bro he does NOT swing three times
[07:17:21] on that, bro. He does not swing three times on that, bro.
[07:17:24] He does not, bro. I'll play this one, bro. I'm going to try and get the bomb. so so so so I'm not sure if you can see the so I'm not sure if you can see it, but the oh my god holy it's like when you it's like ah it's
[07:19:19] like what the fuck?
[07:19:25] That was a better run.
[07:19:35] That was a better one.
[07:19:54] That was actually a better run. so I don't part is locked.
[07:20:09] I think this part you gotta just... AAAAAAAAHHHHH! so so Oh!
[07:20:55] The only reason I'm not too mad right now is because this is the last one, bro. I Place your eye Bro, I'll face... Yo, I ain't gonna lie. Anybody who freaks me out...
[07:21:27] Somebody remind me after this, this is a ceremony. I'm not sure if you can see it, but the Yo!
[07:21:56] Good morning.
[07:22:00] If a nigga pinpoint exactly where I missed my free runes at,
[07:22:02] I got a bag for you.
[07:22:04] I got a bag for you, man.
[07:22:06] First thing to do it.
[07:22:10] First thing to get...
[07:22:15] If a nigga pinpoint exactly where I got my runes and didn't get my rune's at,
[07:22:21] I gotta bag for you Simba, I still owe you a money. Not a bad idea. I'm on the back.
[07:22:45] My morning time...
[07:22:51] My morning time with a nigga literally pinpoint all my shit where I missed it.
[07:23:01] I got a bag for you.
[07:23:06] No, no! got a bag for you not sunny Oh God study if you find those I I got a bag for you.... Hold on a sec. He texted us, nigga? Shut your ass the fuck up man. Hello
[07:24:27] Yeah, yo Sonny if you do that bro! I got you a quick...
[07:24:31] Alright Sonny
[07:24:33] Let me know this is about it.
[07:24:35] I got you with 5 thousand
[07:24:37] First person to do it
[07:24:39] I'll pay somebody $5,000.
[07:24:42] I'm telling you right now, I'm not even gonna lie...
[07:24:45] You're navigating!
[07:26:19] So that's battle right? I'm not sure if you can see the so so so so so Oh my god bro. I'm about to cry, my nigga.
[07:26:23] FromSoft you done did it again, my nigga.
[07:26:28] Allerin you done did it again bro wrong truly breaking down the cat choice
[07:26:33] surely break it somebody down down
[07:26:42] again Oh, my god. so so so so so so so so so I'm not sure if you can see the Oh my gosh, man.
[07:29:03] Oh my gosh.
[07:29:10] Hey, Guff'em!
[07:30:52] Nngh... Maybe... oh so so so Holy shit, I don't like that. I gotta just learn this thing. so Wait, look you can use the- wait! Sonny, you could could use the rune multiple times
[07:30:58] so like you can use it regardless of phase one or phase two I think he just said duh.
[07:31:09] But we were just talking about how...
[07:31:20] I'm really not gonna die! I really don't... I don't know what to be saying myself, bro. That's a lot of health loss.
[07:31:22] What y'all think?
[07:31:24] I'm gonna go with the thing Bro how is he
[07:31:43] How is he cooking me this fast bro?
[07:31:48] Bro, how is he cooking me this fast?
[07:31:56] How is he cooking me this fast?
[07:31:59] Is Tasha a different build?.. I
[07:32:41] Might need to talk to somebody chat i'm ready to call rage real quick because i'm because i'm tight Hello, where's...
[07:32:54] What am I looking for?
[07:32:58] Chat what am I looking for?
[07:33:02] I'm not sure. I don't know. Uhhh. What am I looking for?
[07:33:08] Something I forgot.
[07:33:12] Oh yeah! Different building. Oh, yeah
[07:33:21] Okay what do y'all recommend like how can i be my strength
[07:33:41] music I'm gonna take a picture of my shit.
[07:33:47] I'm taking a picture on my shit just in case i wanna get back to it, I don't know. Oh! Is it thy wish?
[07:33:59] Hey, although I hated you.
[07:34:03] You a trooper.
[07:34:04] Not gonna lie.
[07:34:05] Shout out to this bitch, she the real MVP.
[07:34:10] Huh?
[07:34:29] Huh? Huh? Be not alarmed. Give me the easiest one.
[07:34:31] More a fear...
[07:34:33] Give me the easiest one!
[07:34:34] ...and birth thee as a sweeting fair and fine so I
[07:35:05] and Look at my neck. Oh, man.
[07:35:28] Chat is shit crazy, bro.
[07:36:28] I never had a game like make me have to go do shit like... I'm sorry. Where are you? uh so I'm gonna go back to the These are all rules. Am I bugging? I'm gonna bug it. Fuck.
[07:36:48] Blood test, great katana?
[07:36:50] What is that fire? Oh kill those guys. Nobody want that fucking shit. Oh!
[07:37:34] Nobody wants to shit, man. Damn... Damn.
[07:37:45] Ah! so Ewww.
[07:38:16] The fuck, is that a fucking baby?
[07:38:21] Is it a fucking baby?
[07:38:29] Bitch caught two babies one night. Bitch collecting babies while they're young?
[07:38:40] Ah, fuck. Somebody said wait. Okay, so chat. What do we need to keep?
[07:39:01] Vagor right? right
[07:40:49] holy build wait what's a holy build? foreign what else do we need chat. so so so so Okay, wait hold on. What's a good mind? Wait what's a good mind with good mine with the mind was good mind but it was good
[07:40:52] mind
[07:40:59] put on our way home what's mind? And what's good endurance?
[07:41:03] What endurance did I just have?
[07:41:11] Wait, I can check. I'm dumb as fuck. 41. Add Ar- Arcade was 60.
[07:41:37] The exterior is 37, the goal
[07:41:41] is 60 Now I'm going to be out-tuning a lot. What's good Arcane?
[07:42:17] But our Arcane was so good though.
[07:42:25] ... I know, I know, I know. so so so so so so so My ender was at 41? 241 so My Dex is 37, I'm on a 50 now what's up
[07:44:45] wait it's so straight ass My endurance is low I understand. I understand it. How much for Gordo chat?
[07:45:22] Oh,
[07:45:23] yeah.
[07:45:24] Yeah.
[07:45:25] Yeah.
[07:45:26] Yeah.
[07:45:27] Yeah.
[07:45:28] Yeah. Yeah understand it. How much for Gordo chat?.. so Oh my god this is bad chat. so what is intelligence so so so What I need?
[07:47:35] What should I have shit on so so I'm going to go for the tag.
[07:48:17] Mid for the tagie depreciating ago
[07:48:28] I'm out with that 21 brown
[07:48:53] hold on how does look How the hottest look? My look, my Vagoda was at 60.
[07:49:00] My mind was at 21 is now I'm 25. My endurance is that 41 is at 39 with the tailsman of the turtle.
[07:49:07] 18 strength.
[07:49:09] My dexterity was 37 and I was at 50.
[07:49:12] My RK's at 50.
[07:49:16] My RK was at 60 and now it's at 45
[07:49:22] Wait I have more MIND though! How does that work for L2 if I have more mind though how's that worth for l2 to have more
[07:49:24] mine I My dick's too...
[07:49:46] Oh, my shit is right here. I'm fucking dumb.
[07:49:49] Oh my god, my shit's right here. so Okay.
[07:50:13] Okay, I don't want this nigga to bleed!
[07:50:17] Like, I want big hits. So what is that?
[07:50:21] I just want-I just want big hits.
[07:50:25] ... I want big ass hits, hold on. so 60 right?
[07:51:03] Wasn't my Arcane last time? 60?
[07:51:20] And what do I need, what do I need?
[07:51:21] What do I need? I need Mind.
[07:51:25] And what else do I need?
[07:51:29] Endurance.
[07:51:38] Fuck. Strength.
[07:52:27] Strength. strength I'm sorry. Faithful. 50 decks, 50 Arcade? So what am i taking off Like this? Okay.
[07:53:15] What if I put my mind back down to the original...
[07:53:20] Original 1, which is 21 and I've put the wrecks on...
[07:53:26] Arcane.
[07:53:28] Oh no, Endurance!
[07:53:33] I'm about to go 20 Mine...
[07:53:37] Should I pick one? What do you think? endurance or...you think endurance will be good?
[07:53:41] Or you think I need that endurance bro?
[07:53:59] Oh yeah! Who would y'all niggas put it on? Between Dex or Arcane?
[07:54:03] For how I play.
[07:54:12] Arcane lowkey, bro. For that blood? Dex?
[07:54:20] I'm not sure dexterity...
[07:54:29] Bro, mind you.
[07:54:30] My dexterity was at 37, bro 50 will be a big ass help to him Like this?
[07:54:59] Yo Sonny get ready to find the other things for the bitch.
[07:55:09] You don't need that much... you don't need that much just in case
[07:55:11] I gotta rebuild.
[07:55:16] I'm gonna tryta shit, yo.
[07:55:28] Yeah, I like this.
[07:55:39] You really should farm chat. So we get more, we really should farm!
[07:55:43] Cuz what's the goal?
[07:55:46] The goal is to have what
[07:55:49] the the goal is i have for the for whatever my dexterity whether on
[07:55:55] my arcane and what are on my mind? Yeah, I know. I know.
[07:56:22] I'm gonna have a little arcane in there, bro.
[07:56:26] Ah! You are now
[07:56:28] a sweeting full fine and fair.
[07:56:35] Chat fuck it let's go lock in.
[07:56:38] Fuck it.
[07:57:26] Why am I making a- a My Player, bro! so so 3,000!
[07:57:35] Okay. Okay! Okay, that was 2k. That was 2k.
[07:57:37] And what's that from?
[07:57:39] Arcane?
[07:57:47] Oh, okay. And what's that from? Arcane? I know that's good, I know it's good. Is that from an arcane or is that from a dex?
[07:57:51] Is that really from Dex? Really?
[07:57:59] Okay, okay okay both okay
[07:59:00] yeah that's good damage so so so Okay. Wait, wait, hold on! Hold on, that's not bad.
[07:59:02] I got hungry, I got hungry,
[07:59:04] I got hungry,
[07:59:06] That's not bad, that's not bad,
[07:59:08] Progress bro, fuck I love when we do this shit y'all!
[07:59:12] TAKE THIS OFF OUR FUCKING BOAT MAN! so uh so so so That was bad, that was a bad attack.
[08:00:25] We have to get a good start, we have to get a good start.
[08:00:29] Oh hell nah 666 fuck no Jesus is King so so I'm greedy, I'm being greedy.
[08:01:32] I'm being greedy, I'm being greedy, I'm being greedy...
[08:01:35] Chat, I don't know why like-
[08:01:38] Like L2 just seems like the only- Like I need to learn how to use l1 but god damn bro
[08:01:42] i don't know why l2 be just like so so so so so I'm not sure if you can see the Fuck. so so so so I'm not even gonna give you a chance, bro.
[08:03:49] You're nothing to me than giving me a chance!
[08:03:54] I'm just gonna go ahead and kill this guy. he doesn't even give me a chance
[08:04:07] change weapons bro what is there weapons that can go higher than
[08:05:04] i'm at max is there weapons that could go higher than i'm at max is there weapons that can go higher than this are these not crazy so uh I'm not gonna lie, bro. I'm not gonna lie bro. I'm not gonna lie like what?
[08:05:06] Like what combo is that bro?
[08:05:10] What combo is that my nigga? What combo is that my nigga?
[08:05:13] What combo is that my nigga? What combo is that my nigga? AHHHHH so so so Oh, man. so so so so so Oh my gosh! so so so so so so What the fuck?
[08:08:36] Come on, bro.
[08:08:38] Come on, come on, come on...
[08:09:26] ... so so so Like, that's the- whoa. Like what?
[08:09:31] That's gonna cost us a late round bro.
[08:09:33] If he put out some dumb shit like that
[08:09:35] bro, and his ace low
[08:09:37] like... That is a slow light. so so Again, again, again. so I'm not sure if this is the right way to go, but it's a good idea.
[08:10:50] I'll try to get out of here before they start attacking me. When does he ever do a three swing? When does he ever do three swings bro?... Hold on, chat.. Come on, bro. uh oh come on Lockett bro!
[08:12:53] Come on! Who's struggling too? Let me see so. Is he struggling?
[08:13:48] Ah, fuck.
[08:13:51] I feel your pain bro.
[08:13:59] Better there though? That wasn't even... There wasn't even a bleed proc on that so we should be fine.
[08:14:03] I feel your fucking pain bro!
[08:14:05] Once i figure out how phase 2 works...
[08:14:11] He wanna shake hands?
[08:14:15] No mana! What build is this? Oh, his Vagor's up!
[08:14:26] No way I keep missing. Oh my god, is that slow?
[08:14:45] Is this shit that slow?
[08:14:47] He's still casting.
[08:14:48] Am I the only one doing fucking...
[08:14:51] ...mana?
[08:14:56] Oh, hey he just doing this because it's like his bill Oh he's, oh my god.
[08:15:16] He got Pacers chat. Chat if they got Pacers bro.
[08:15:46] One punch! Still haven't hit a bleed drop on him yet.
[08:15:53] This nigga won punch man!
[08:16:01] He's flowing though. He got flow Bro he got flow check. I like how he moves bro. Oh.
[08:16:37] That's how you do it, man! Ooh, what? That's crazy.
[08:16:38] This doesn't hit.
[08:16:41] Whoa, one punch?
[08:16:47] What the fuck?!
[08:17:20] Oh I'm dead. Oh no.
[08:17:26] I've seen all these moves on God.
[08:17:50] What have you done? I missed 20 what?
[08:17:52] Somebody get the 20.
[08:18:45] Yo, yo, yo Barcelona. Thank you so much for the 20 gifted bro. so so so I'm not sure if this is the best way to do it, but I think you can just go with what's in your hand.
[08:20:44] I don't know why they're doing that here... Oh my gosh i gotta be more patient huh i'll be way more patient fucking uh so so so so Oh man! Oh my gosh, bro. Oh yeah, my fucking...
[08:20:48] Wait hold on, my weapon? Wait that nigga was- wait now that I think about it...
[08:20:56] Wait! His shit was here for a band. Every shot! every shot Oh, these weapons act?
[08:21:15] Sunny!
[08:21:20] My prop bleed was 2l2
[08:21:27] yo what's the best okay for me like my play style what's the best weapons
[08:21:31] what's it what's the name of your weapon I'm going to have back to the belt and try it again. Great katanas.
[08:22:10] Let's take the bat- wait so it's easy to upgrade these weapons right
[08:22:17] these like uh like weapons are easier upgrading this game like once you want
[08:22:20] to beat this is easy Okay, so... Do I need another baby for this bitch
[08:22:40] this bitch needs another baby
[08:22:51] chat what's the hook ones that everybody can talk chat what's that hook one that niggas be talking about
[08:22:55] oh my god
[08:22:57] whats that hook one chat
[08:23:15] this is like a ho it's two hooks Yo, where's another baby?
[08:23:16] Where's the baby at?
[08:23:16] Where's the baby at? Someone can drop for you or not that yo what's so okay Yo, what's another liver? What's another liver? Hold on.
[08:23:52] I think so chat we might have to go wait hold on.
[08:23:55] So Sonny you think 80 RK is the number one thing that you can do in this game?
[08:24:00] Yeah, yeah.
[08:24:01] You know what?
[08:24:02] I'm not gonna lie. I don't even know if it's a good idea or not. I mean, I've been playing for like 20 years now and I've never played any games so chat we might have to go wait hold on so sonny you think 80
[08:24:05] 80 arcane would be like damn like we chucking him down I'm thinking about it right?
[08:24:20] I can already tell what I need. hold on let me see
[08:24:26] i can't even tell what i need i'm not gonna lie Wait, you can do two Uchi Tainas?
[08:24:41] Hold on.
[08:24:44] What the fuck is a youtube channels with rock grease and one jump l1 might take an instant to phase two
[08:24:53] what
[08:24:58] with what i What? With what attribute?
[08:24:59] But Masha gotta be insane? anyways it's the phase two bro I don't even know if i have rock boots
[08:25:41] and i could run out of that
[08:25:45] i've won Yo, find another
[08:25:54] delivery ship.
[08:25:57] Find another deliver ship.
[08:26:34] Okay. find another deliver so. Who we got so that's if I get to
[08:27:08] Yo where do i go so You know if it was up to me, you know what I'd be doing nigga.
[08:27:11] Oh my god I have zero runes though champ. Oh my fucking god.
[08:27:51] How much do I need to level up at? I do got wounds right? couple of these. These low ass runes bro.
[08:28:12] Yo is there any memorances that I can use? so Wait. What the fuck? so so So, child.
[08:29:10] So what do you think I should do bro?
[08:29:12] Wait so I'm waiting for Sonny to give me the um I'm waiting for Sonny to get my arm So what do you think I should do bro?
[08:29:12] Wait so, I'm waiting for Sonny to give me the um...
[08:29:14] I'm waiting for Sonny to give me the um...
[08:29:16] The drop.
[08:29:22] Should we pick up two? Can I- Should we pick up two?
[08:29:23] Should I pick up two?
[08:29:26] For the, for the,
[08:29:29] for two rebirths? yes so.
[08:30:13] . I'm not gonna lie, bro.
[08:30:21] Yo, what's the best method in this bitch, bro?
[08:30:22] There gotta be a better method than this, bro.
[08:31:22] Ain't nobody dropping 20,000. it so Hold on, why everybody say out and be sword? What is it, strong? No for farming oh that ass why Oh, hell no.
[08:31:58] But what a... But why did I grind this on stream bruh? My attributes could have been crazy.
[08:32:26] So my attributes could've been crazy, right? I'm going to to farm this. Should I farm until my next level up or what? All right, man.
[08:32:52] There's no way I can farm this girl.
[08:32:54] This shit take mad long bro.
[08:33:04] Wait Ludwig was 20 what
[08:34:12] but i wonder what what x what exit and Ludwigs builds were plus 20 blessing so Okay. so Yeah, it's all critical.
[08:34:14] Regardless, you just gotta be nice at the game at the end of the day.
[08:34:15] You know that, chat?
[08:34:17] Like, at the end of the day, bro,
[08:34:18] like, you just gotta be simply
[08:34:19] just nice at the game, bro.
[08:35:15] You-you gotta just be good Yo, Sonny you got the two locations. Send it. Send it to fucking drink, huh? What the fuck I'm talking about here?
[08:35:20] My nigga Wacky going-
[08:35:21] My nigga Simba going to drink?
[08:35:23] Why niggas outside bruh?
[08:35:27] Know what I mean?
[08:35:31] Why niggas is outside?
[08:35:35] Wait sacred sword, what's that All we need, come on now.
[08:35:58] We need Beonis man.
[08:36:01] Arcane huh?
[08:36:19] Arcane. Okay, where are we going? Out in Beast Sword? Is it good?.. I don't know. so Man, I just hear that.... so Good.
[08:38:24] Are we good?
[08:38:28] We're good. You good?
[08:39:40] We're good. so so so oh my gosh bro Thomas with the 25kid, appreciate it. Thanks for the 25 gifted you fucking beautiful motherfucker at fucking 4 a.m
[08:39:44] Thank you so much for the 25 gift here bro so This sword? I'm going to go ahead and do that. I Oh, yes. I don't have faith chat
[08:43:36] Oh uh so I don't have faith.. so so I'll bet it. Now. Which one is it? so uh I'm blind. Am I blind? I'm broke. Fucking broke!
[08:43:59] Oh shit. Yo. Stone's never rightate thank you so much
[08:44:01] Bro this game got me doing all types of shit
[08:44:05] This is actually insane bro
[08:45:53] This is actually insane right now, bro. I popped on my rules. so so This should be enough, right? 10 man with a 5, good to appreciate it my brother brother thank you so much gang go five gifted so so Where do I get this wisdom stone from? Fuck, where do I get it from bro?
[08:45:56] Fuck.
[08:46:02] ...
[08:46:15] ... How much do I need how much of each this is expensive as fuck bro
[08:46:23] Of each
[08:46:47] Oh about to win oh my this is expensive bro. Oh I got it. so Ow.
[08:47:15] I need to use some good...
[08:47:31] Okay, now. Damn.
[08:47:42] What a knee, what What this need?
[08:47:51] Sombra Ancient Dragons is what its saying.
[08:47:56] Sombra Ancient Dragons I'm a love
[08:47:59] number each
[08:48:01] money that's not enough
[08:48:18] She'll saw these Oh, she don't sell these. I bet. Now what?
[08:48:34] Oh, fuck. Now what? You got a whiz line? Yeah. now what
[08:48:41] the Man, where the fuck is this sword at bro? Why do you want to put this in alphabetical order? so I need faith. any faith
[08:49:30] don't know that i don't know you know
[08:49:32] deal
[08:49:35] they tell me how to have a space for that problem and not to think about it
[08:49:38] bro for that bro i'm not gonna lie because think about it bro like
[08:49:43] yo um sunny where's that oh you said oh my god so I don't know what you're talking about. Wait, where the fuck- where the fuck did he- wait.
[08:50:38] Yo what are you drop?
[08:50:42] I'm gonna go to the other did he... wait.
[08:50:44] Yo what do you drop?
[08:50:48] Yo Sonny, where'd you drop that?
[08:50:51] Nigga said Sonny, nigga Sonny said I need that 5k
[08:50:56] Let me know once you complete it, gang. Sunny what did you drop?
[08:51:07] Child what are we looking for bro? Oh the fucking um...
[08:51:49] Oh it was right here. so Oh shit, fuck no right?
[08:51:53] Hold on where should I start?
[08:51:56] Or is it in here
[08:52:02] where do i start at the top and come down stop it and come down
[08:52:07] chat so that's up top and then go down
[08:52:12] one to the right this one Yo, shout out to everybody who's still watching.
[08:52:33] Bro we grinding bro. Chat we deadass grinding bro.
[08:52:40] What the fuck is going on?
[08:52:41] I'm used to reacting and shit bro.
[08:52:45] Am i already on my gaming arc right now, bro?
[08:52:49] Have we done did Minecraft, Red Dead Redemption, The Last of Us 2, um what else?
[08:52:58] The Last of Us 2, Ghost of Tsushima, Outer Ring.
[08:53:05] What else? And it's our last walkthrough, okay y'all?
[08:53:19] Because fuck gaming!
[08:53:38] Oh my gosh spider-man but we did a lot bro everyone out when I used to be scared of playing games on the hardest difficulty. I don't think that I will ever play another game where it's not on the hardest to push in.
[08:53:49] I have a 2 in this? I'm going to have to do this again. Is the queue still not good?
[08:54:20] Oh god, is that you?
[08:54:28] GOD! I just found that. I'm going to need and get out of here. so so Is it in here? Where's that oh 10 weeks
[08:56:19] We see a corner of the room AHHHHHH uh so so so so so so so I'm gonna see what's up.. so um I'm sorry. Ah, now. Is it thy wish to yet again be born anew?
[08:59:06] Now bear witness... Alright chat Okay so we need 22 faith
[08:59:10] Right
[08:59:11] All for it
[08:59:14] We need 22 faith.
[08:59:16] Okay?
[08:59:22] And then now what
[08:59:32] Sixty the door And that one and now what what build is I know a bill this is 55 decks 55 Dex.
[08:59:49] Dirty Endurance.
[08:59:54] I don't even know what i'm doing
[09:00:07] bro what Bro, what?
[09:00:14] What is happening? I'm sorry. What do I need?
[09:00:34] What do I need?
[09:00:44] Bro, what the fuck am I looking at bro?
[09:00:52] They told me to get this shit to farm? Oh my f- okay, okay stop. Rewind, rewind
[09:00:56] Hold on, fuckin' rewind
[09:00:58] Wait, fucking re-fucking wind
[09:01:00] What the fu- Fucking rewind fucking rewind what the fuck fucking rewind my nigga hold on
[09:01:09] why nigga what's new what's a new katana build?
[09:01:13] We're doing more arcane, correct? 99. I need 99 on that bitch.
[09:01:27] Okay, hold on a minute.
[09:01:32] Let's be honest 80
[09:01:38] 20
[09:01:42] 19 right or I was at 18
[09:01:49] The wrecks on decks wait no
[09:01:57] This is bad. Oh, this is so bad.
[09:02:00] Wait but that arcane will make it for her right? yo yo yo still sunny what do i do Well what about my endurance? Whoa Endurance Child, what about my endurance? What if I did this? okay so. 25 decks so 25 decks What did we do?
[09:04:18] 70 arcane.
[09:04:21] What did we just 75 arcade? 75 arcane. What the fuck am I doing? Oh, shit.
[09:05:06] Okay, hold on, chat.
[09:05:06] We might... Hold on, chat. We might- we might- hold on chat. Yo what the fuck is going on bro?
[09:05:10] Hold on! We might be onto something bro. uh Yo, what if I change the Ashen War back to Bleed? chat shut up chat shut up you haven't seen nothing yet, bro. I want to put these niggas wrong.
[09:06:04] I actually am going to put these niggas wrong, hold on.
[09:06:10] Now we're gonna try it now I can't it's so underrated. Let me see hold on check out how much damage you do off the gates Wait what? Wait, huh?
[09:07:03] Shall we stay? What was that? Wait, what?! so so so Oh, my God.
[09:08:17] Wait a minute. Wait, hold on.
[09:08:20] Wait, hold on.
[09:08:24] Rain should have been blood right? so Should he not have blood check? I'm gonna do that. i'll probably jump in the gun I'm not sure if you can see the so so so He's not bleeding.
[09:09:58] 5000!
[09:10:01] He's not bleeding.
[09:10:03] It's the same shit!
[09:10:05] Yo, I wanna go back to the build that I was just at.
[09:10:08] Oh my gosh...
[09:10:10] My god what is going on?
[09:10:14] TIGA MINGO!!!
[09:10:16] The 50 gift- Tiga...? TIGA MINGO! WITH THE 50 GIFT-
[09:10:18] Tiga...
[09:10:19] ...Mingo.
[09:10:21] With the motherfuckin' 50 fuckin' gifted,
[09:10:25] you fucking beautiful motherfucker. Thank you so much
[09:10:31] thank you so much so so Whoa! Whoa.
[09:11:13] Wait, is that another 50-kitty?
[09:11:17] Is that another 50-kitty?
[09:11:21] Yo! 150 gifted! YO!
[09:11:25] YO!
[09:11:29] 150? 150?!
[09:11:53] What the fuck? yo tikka mingle and tilt igamino with the 50 gifted thank you so much brother what the fuck yo it's 4 a.m
[09:11:59] wait what
[09:12:02] another 50 Another 50! what the What the fuck?!
[09:12:31] Take a month long with another 50 fucking gibbons you beautiful motherfucker!
[09:12:35] What the fuck, another 50 fucking gifted
[09:12:40] 250
[09:12:43] hello Hello
[09:12:58] Thank you bro. Yo, appreciate that bro for real bro.
[09:13:01] What the fuck?
[09:13:03] That nigga's Mr. Beast! so so Oh my gosh, I hate when a boss sends me off like that, bro.
[09:13:57] Yo, um...
[09:13:58] Sonny!
[09:14:02] I wanna go back to the build that I was before this.
[09:14:09] If you find them frags exactly where they're at... You getting the money.
[09:14:13] And then,
[09:14:18] chat and what else? Chat, what else? What else?
[09:14:20] What else?
[09:14:22] What else? What else? chat and then what else I'm gonna watch people struggle
[09:14:26] that's what I wanna do to feel better about myself
[09:14:30] that's what I wanna do to feel better about myself I's what i want to do to feel better
[09:14:33] about myself i wanna i don't know why people struggle
[09:14:40] who is struggling right now? Rage?
[09:14:44] Let's go to rage.
[09:14:49] Yo, I... Tigger with another 50 fucking gifted. you so fucking much you beautiful motherfucker
[09:14:58] thank you I fucking love you thank you
[09:15:05] Oh Thank you. Wait, why am I jumping?
[09:15:09] Thank you bro Another one! Oh my gosh
[09:15:11] Bro
[09:15:13] That's how i'll acting, huh, chat.
[09:15:16] I ain't counting that eat my dick. What you mean drunk?
[09:15:20] Yeah, that's how I be acting
[09:15:22] Y'all niggas some gay ass niggas
[09:15:24] kill ya kill yo yo yo fuck y'all telling me to jump yo yo yo yo rage yo Get the fuck off me!
[09:15:42] Take me to the bitch. Where's the boss? bitch
[09:15:52] you niggas annoying bro
[09:15:56] that's how i be feeling you see me, bro
[09:16:01] Tell them I'm watching tell him I'm watching
[09:16:08] Fucking Look at my remote. Look, look at my remote unplugging. Look at my fucking remote!
[09:16:13] The fuck is that?
[09:16:16] Look at my remote!
[09:16:17] Look at my remote!
[09:16:21] LOOK AT MY REMOTE! LOOK AT MY REMOTE!!! Look at my remote! Crap Come here, hoe-ass nigga.
[09:16:34] Come here, hoe ass nigga. Fuck off.
[09:16:43] Fuck off, nigga!
[09:16:47] What the fuck is that? Look at my remote! Look at my remote!
[09:16:52] Look at my fucking remote!
[09:16:54] LOOK AT MY REMOTE!!!
[09:16:58] I can't move, I can't move. That don't count.
[09:17:00] Yo fuck this!
[09:17:06] It's not even working anymore.
[09:17:24] Ehh I'm gonna kill myself.
[09:17:32] Oh, this feels so good.
[09:17:35] It feels so good on this side, chat.
[09:17:37] Where do I go, chat? Just straight...
[09:17:39] Pfft!
[09:17:40] Move along with me dick eater. more struggling chat
[09:17:50] oh that's cringe. I'm gonna be so mad bro. so I can do phase 1 flawless, hitless every single time.
[09:18:39] It's just this shit.
[09:18:41] This is the biggest load of fucking horseradish I've ever seen.
[09:18:45] Oh god... i'm good And here it comes again, he's getting me with that fucking bullshit blaster.
[09:19:07] He's already used it twice in this one alone.
[09:19:14] Oh, God, whoops.
[09:19:18] See like THIS I have no problem...
[09:19:20] ...oh, okay
[09:19:23] I haven't had any issue with that until right then
[09:19:32] That I can do. Like if he just had his normal attacks with like the light
[09:19:36] that fell behind it, I would have completed this 20 tries ago
[09:19:40] But he has these absolute
[09:19:42] fucking baloney moves like this.
[09:19:49] Like I can't even see
[09:19:51] what I'm looking at.
[09:19:52] Like... Like I can't even see what I'm looking at.
[09:19:59] Oh, here it comes... right in my fucking ass.
[09:20:04] Nevermind, I'm swift.
[09:20:08] Really?
[09:20:12] I can't see. I CAN'T SEE! I CAN'T EAT!!!
[09:20:21] Unlucky.
[09:20:32] Guy rage watching you?
[09:20:34] Hey man, it's tough.
[09:20:36] This is actual
[09:20:38] fucking fish paste.
[09:20:43] Fuck you some schlong.
[09:20:48] Like phase one, I can do hitless.
[09:20:50] It's just phase two.
[09:20:52] It's like damn near impossible. At least with fists it is.
[09:21:02] It's actually a skill issue.
[09:21:05] Bro, nah bro.
[09:21:07] Like I feel like
[09:21:08] I gotta get back on bro.
[09:21:14] Nah man.
[09:21:19] Look at that ass fucking build Oh my god.
[09:21:39] But chat, this nigga is annoying
[09:21:41] bro. Chat like do y'all understand
[09:21:43] how annoying he is?
[09:22:23] ..... Jay-Z's gay? When?
[09:22:27] When did somebody say that
[09:22:36] i'm acting like a twitter nigga... chat like
[09:23:22] I've been
[09:23:24] I'm getting off I've been...
[09:23:29] I'm getting off. What the fuck, bro?
[09:23:31] Like what?!
[09:24:40] That was a sign, bro. so I'm going to if you can see the so Oh my gosh!
[09:24:47] How are people getting through the first phase hitless?
[09:25:01] Hitless. Hit list! Oh! Ah! I'm going to have to do this again. so so so I'm not sure if you can see the so so I'm not sure if this is the best way to do it, but I think you can just go with what's in your inventory.
[09:26:23] I don't know why they're doing that here... I'm not sure if this is the best way to do it, but I'll try.
[09:26:34] I think that's a good idea. Fuck!
[09:26:41] Fuck.
[09:26:45] I gotta learn his attack.
[09:26:49] Gotta learn his tech for sure.
[09:28:08] I gotta see what the fuck he doing bro. uh so I'm not sure if you can see the so so I'm not sure if you can see the Oh! Slowly learning angle. Ah, slowly, slowly, slowly, slowly...
[09:28:12] Slowly, slowly, slow.
[09:28:23] The I'm going to try and get the gun. so so I'm not going to let you get away with this. so so I'm not sure if you can see the so Fuck this shit.
[09:30:09] Fuck this shit.
[09:30:12] Fuck this shit this man What time is it?
[09:30:26] Five o'clock.
[09:30:34] Look, look, my chair's dead.
[09:30:37] Look, my fucking chair is dead bro!
[09:30:45] Oh my goodness man.
[09:30:58] Check out the outside world, is it fun to be outside?
[09:31:19] Is it fucking fun to be outside bro? side bro Hold on. When I say T-T, you say S-TT.
[09:31:27] TT.
[09:31:28] And when I say TT, you say S-TT.
[09:31:33] TT.
[09:31:35] Welcome to. Welcome, ladies and gentlemen.
[09:31:45] Check! Oh my God, Chet i want you to understand something okay
[09:31:53] hold on let me see what's this right here i'm using the same link.
[09:31:58] Sorry, same link body.
[09:32:01] Oh my gosh! Who just said that?
[09:32:04] It let me let me XO.
[09:32:07] I love you.
[09:32:09] The 90s, I love you. LelaniXO,
[09:32:10] I love you. Thank you so much.
[09:32:12] You remembered.
[09:32:14] LelaniXO,
[09:32:14] I love you.
[09:32:20] LelaniXO, I love you. Leilani XO, remind me about it.
[09:32:23] I fucking love you.
[09:32:45] Leilani fuck... Lainey fucking XO nigga. chat okay i got a question chat
[09:32:49] no, I don't have a question. Um...
[09:32:52] Wait! Sonny! Link is the same link for my TTS
[09:32:56] I'm using the same one from yesterday. Or do I need to do a new one... chat
[09:33:42] yo chat Yo chat, oh
[09:33:47] It has to be anyone Okay uh
[09:33:58] okay let me see real quick
[09:34:24] I want you to understand something. Tomorrow may possibly be the day we succeed. May, may and I'm praying everybody pray bro. Everybody pray like that ass bro we keep going thumb hard on the same boss eventually he gotta break eventually you gotta break bro right
[09:34:33] right Test it, test it.
[09:35:01] Test it. Oh my goodness. oh my gosh
[09:35:12] can i test is it tested test cts It's not on?
[09:35:26] Can a mod do it?
[09:35:32] Can a mod test it it should be on okay
[09:35:36] let me get a hold of the browser is 1920 1080 1080.
[09:35:58] I'll try. I don't think it's on.
[09:36:07] It's not on, it's not on, it's not on, it's not on.
[09:36:11] Oh my gosh I was hoping
[09:36:28] I'd get today
[09:36:29] But no
[09:36:30] Another day
[09:36:34] On the fucking concrete bro.
[09:36:38] ANOTHER DAY ON THE FUCKING CONCRETE BRO
[09:36:41] Hello Kai Huge Fan, but hold these back shots, Sark-Hewy.
[09:36:51] What?
[09:36:51] What?
[09:36:52] What? Yo!
[09:37:17] You stupid... You smell. The problem isn't the problem, the problem is you can't dodge anything. I know, that's where it gets bad.
[09:37:42] Hey! Stop!
[09:38:12] You should play Kingdom Hearts on Critical Mode or Ninja Gaiden. So you think I got bad luck because I broke Mesmer's head?
[09:38:20] I love watching him walk around the room. Looks like a little action figure is running around Aw, bitch
[09:38:25] You fucking bitch is running around. Kind of like I had a
[09:38:27] basketball game today and like
[09:38:29] I was rebounding, the ball was gonna
[09:38:31] go out and I threw the ball at a kid so like it can be
[09:38:33] out on him, and when I did it
[09:38:35] The ref who was a girl was like
[09:38:37] That was nice. Do you think she wants it?
[09:38:41] Remember the algorithm for the fight, bro? And they timed me out for praying for you in chat this morning.
[09:38:51] Your problem is that you can't dodge anything, try dodging, it's not the build.
[09:39:02] Why was your Chinyash long so hard before?
[09:39:13] I did the math and you've died approximately once every five minutes for
[09:39:20] the entirety of the stream so far. What do you think of Let Me Solo, huh?
[09:39:30] He's a goat!
[09:39:33] In my body.
[09:39:36] Rehannam gonna keep kicking you down the water. I'm a bug!
[09:39:39] Rahab, I'm gonna keep kicking you down wild boy. El Gamer. Rat Sennett.
[09:39:41] Uck, uck, uck, uck, uck, uck, uck, uck, uck, uck up
[09:40:00] get some sleep, Stinky.
[09:40:09] Yo chat! I'm not even going to the bottom of y'all niggas.
[09:40:17] Yo, I-I yo I'm not even going through do... Listen to me.
[09:40:22] Is it all hock season or not?
[09:40:25] Little chat, look.
[09:40:27] I'm not even gonna do
[09:40:28] motherfucking
[09:40:35] Love you, bro freezing from Austria. Yeah, we're gonna do the bottom on your eyes So me Oh my gosh, like I'll be telling my assistant bro get good silky do- this is poly i see right through this why did the death counter
[09:40:56] reset to 660 700 earlier i want my points.
[09:41:02] I see right through this shit!
[09:41:06] Bust down Rolly Avalanche.
[09:41:08] I want to suck your toes dipped in ranch.
[09:41:11] Your stats are finally good. Game is just hard.
[09:41:13] Try to get Knight of Sword Katana tomorrow,
[09:41:16] it's pretty good."
[09:41:21] But I don't think attacking is the problem.
[09:41:24] It's me fucking...
[09:41:30] ...it's me dodging!
[09:41:32] Bro, this bum ass fucking...
[09:41:36] Can I not go into lie, you gotta stop peeling in front if the boss is.
[09:41:41] I know. good night my punky wookie bear i'm gonna watch you in your sleep just to make sure
[09:41:52] you are safe if I fall asleep im gonna force myself to dream about us
[09:41:56] together in the elden ring world beating radon
[09:42:02] yokai i wanted to say thank you for providing us content almost every day. You work your ass off
[09:42:08] I have watched your dead marathon the entire stream not turning it off as well
[09:42:13] It's the ghost of sashima which was on my b day while i was sick
[09:42:17] w marathon then this you're my favorite streamer of all time
[09:42:21] thank god changed my life so is it confirmed tra Scott 24 hour stream July 11th?
[09:42:31] Shhhhhhh
[09:42:36] You can't dodge for shit. Do a few rounds of learning his moves. Get good.
[09:42:42] This is a bad, this is a bad do-rag I'm not gonna lie but we ain't complaining.
[09:42:47] You know what I gotta get? I gotta get the Bobo cap chat
[09:42:53] So I got the bubble cats bro
[09:43:00] Oh Is it Bubba or Boo-Boo? I need to find that side shit again.
[09:43:04] Rat Senate rat senate rat
[09:43:08] Senate you aren't beating the game.
[09:43:17] Stick to Minecraft lil nigga. Minecraft, little nigger.
[09:43:29] Let's take some minecraft Please react to Qwop on YouTube, he did a hitlist run on all DLC bosses.
[09:43:35] It is insane.
[09:43:36] Alright we gonna see bro.
[09:43:40] We have I'm Gonna Haunt your dicks and blows I'm for once.
[09:43:59] Yo,
[09:44:00] mods are not a routine.
[09:44:01] If anything happens to my stream
[09:44:02] or anything like that call my phone down call it
[09:44:05] crazy as the beast says if i gift you 10 rex will you win for me boy what the What the fuck?
[09:44:21] I gang don't feel bad about yourself because I started a new game and tried to catch up with you
[09:44:26] And i just made it to the first boss on the DLC, Lman.
[09:44:35] Hi React to Problem Child and Mojo Jojo its cartus new leaks
[09:44:43] your dodging is good don't rush the attacks one attack at a time and then back off.
[09:44:46] You got this!
[09:44:50] Kenny Poo dropping on July 5th.
[09:44:52] ... Radon, radon, radon, radon, radon, radon, radon, radon, radon, radon, radon, radon, radon.
[09:45:13] Fix the death counter you ain't fooling me 730 deaths.
[09:45:24] Yo Chad!
[09:45:25] Good night my little dwarf child, hope you sleep well shorty
[09:45:29] nigga we're whooping this nigga guy
[09:45:33] bro we gotta start bro he's tanking him excuse me says
[09:45:37] damn lil nigger when will you beat the boss?
[09:45:47] My sunshine my only sunshine you make me me happy when skies are grey you'll never know.
[09:45:53] Dear how much I love you please don't take my sunshine away the other night.
[09:45:58] Dear as i lay sleeping i dreamed I held you in my arms
[09:46:00] when I awoke.
[09:46:01] Dear,
[09:46:01] I was mistaken
[09:46:02] so I hung
[09:46:03] my head and cried.
[09:46:04] What takes them
[09:46:05] so much, Chad?
[09:46:06] What is that?
[09:46:08] You panic dodge
[09:46:09] way too much
[09:46:09] one pump.
[09:46:10] what like drains their...
[09:46:12] what gives them a whole bunch of um
[09:46:14] damage?
[09:46:20] Get some rest and get after it tomorrow. W stream.
[09:46:25] Oh my gosh bro...
[09:46:31] Don't worry Pookie, tomorrow is the day. The Elden Lord will have the Shadow Realm. Now goodnight I love you man. Can't wait for Sekiro to break you lol.
[09:47:03] Goodnight Pookie Bear! See you in the morning to get this massive victory royal!
[09:47:12] Sleep well in the Fifty Shades of Kaikum dungeon.
[09:47:23] Have a good sleep my little nigga Loki going to stroke my shit any recommendations my little dwarf?
[09:47:34] Get off the phone and sleep, nigga.
[09:47:39] Hey fucking yo, bro.
[09:47:45] I will gift you 10k subs if you let me hit.
[09:47:49] What?
[09:47:55] Hi my sister is 21 she wants you to eat from Australia.
[09:48:03] Chat! Oh my gosh bro I'm not doing this-
[09:48:06] You need to get into the mentality of your friendly neighborhood Spider-Man and you'll get his ass. Pokemon says Pokimane says, damn nigger when are you gonna beat the game SMH?
[09:48:39] Porkchewa
[09:48:49] The way to cheese him is heavy builds with a lot of weight and poise but don't be a bitch love you goodnight dwarf.
[09:48:57] Goodnight bro
[09:49:15] Hiya I can give you two Godskin Peelers Max Level and Bleed effect already on the Lit of Bleed build up 111. Yeah, fellow viewer from the Bronx, have a good sleep. Tell it to the fucking Bronx.
[09:49:29] Broken asleep when I wake up? Sucks 7 years old. I only got PayPal though. off paypal though A wise rat once said you gotta lose sleep to have a clean sweep.
[09:50:05] What happened now kidding watching from dubai bro
[09:50:12] ask santa for his blessing to be trade on your next shift.
[09:50:22] How you came with an end boss cosplay, but ain't beat him yet.
[09:50:33] I wish I could be on top of you right now while beating my shi and just bust on that fat ass phone head. You
[09:50:40] megamind pussy fucker bitch fuck. English or Spanish?
[09:50:57] Hi, what's XQC's gameplay on the last boss?
[09:51:03] I feel like...
[09:51:08] Would make my year if you could I feel like...
[09:51:13] It would make my year if you could simply say gobble dem cookies goodnight sweet cheeks
[09:51:24] Eula Chacky Tawai Adomir Algo Elvar
[09:51:55] Love from Dubai Yo! yo w right btw Happy birthday, Jay. get a happy birthday jay
[09:52:16] there's a roach on the rock by your head cat Hi Ike, if you heard me she's 21 she's got a giant. I heard you.
[09:52:37] Kai, let me see your sexy toes.
[09:52:40] No!
[09:52:50] Hi. Trump 2024. Mink, mink, mink, mink, dream of a dream where you're dreaming of the dream you want to dream.
[09:52:56] Mink, mink. where you're dreaming of the dream you want to dream.
[09:52:56] Mink mink!
[09:53:00] Do you think this second time playing a long marathon for a game with countless rematches
[09:53:04] has given you an epiphany in how you won't do such long games for marathons again?
[09:53:10] No.
[09:53:13] You got this Kai, I believe in you fam one day you'll defeat that MF also we friends though goodnight fam
[09:53:28] Freaky ass ninja you're 69 ki freaky ass ninja you are 69kai, freaky ass ninja you are 69kai.
[09:53:44] Are you even ready for Sekiro? Cause you gonna get mad mad! Believe me. mad believe me what are you watching kai i'm just watching a youtube video uh, YouTube video.
[09:54:07] Hello nigger my name is Rahad and did you really think
[09:54:09] you would beat me? Huh, you puny little rat.
[09:54:13] Invite Tyler back on your stream and he'll go easy on you.
[09:54:19] Hey Yoshisan, you've been invited to the Diddy Party. Press 1 if you want to come to the Diddy Party.
[09:54:31] Kai can you please say happy birthday to my friend Gobbledemcookieslovethe stream?
[09:54:37] Happy Birthday!
[09:54:40] Goodnight K, see love your stream fam nd keep the hustle.
[09:54:51] Bro just look up best weapons that scale with dex and strength. Easy clap!
[09:55:02] Do give away pussy boy
[09:55:19] Good night brother from New Zealand. Goodnight bro.
[09:55:21] Goodnight chat!
[09:55:23] Hi, say Pina Nellie sir. Apun and Elisa.
[09:55:33] Kyubina Stream DBs sparking zero, also high from Marine Corps base New River North
[09:55:38] Carolina
[09:55:43] yo can I get a pc please Why is he tearing up? up boy.
[09:56:15] Why are you crying, Kai?
[09:56:26] Yo is this dude cryin'? Dude crying.
[09:56:39] Tapping in from the UK stayed up all night hoping you was gonna get the dub but fuck it we go again later.
[09:56:42] Next time your in the UK come to Manchester and see where the real G's at.
[09:56:50] I don't believe in you. I think you should quit.
[09:57:00] Yokai, can you help me get my egg back? It's been hacked. I love going into your luscious face. mumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumumum Yo KC3 when are you coming to Sweden?
[09:57:40] I'll take care of you here baby, but we friends though
[09:57:44] LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllll The hardest boss ever, makes Millenia look like a joke. You're cooked my guy you won't be able to finish it.
[09:58:01] Deezer stream chat gahoot yetz der bundesrepublik deutschland yet step on this republic george land
[09:58:11] what time you waking up later kai Chow time should I wake up?
[09:58:25] Yokai finally got to do one of my lifelong dreams today.
[09:58:29] Let my dad come in my ass and wiped it across the floor and became the snail I always wanted to be he might be tired chat, stop bugging.
[09:58:47] Hi stop moving I am almost finished
[09:58:57] Keep her head up gang gang. You ain't got a cry. Can you say a goodnight prayer?
[09:59:05] Father God...
[09:59:08] Kai would you come visit Guerrero, please? God.
[09:59:13] Kai, would you come visit Guerrero Mexico? Father God please watch over everybody
[09:59:15] in this chat
[09:59:17] make sure that we're all having a good night's
[09:59:19] sleep hopefully I'll wake up tomorrow with great happiness,
[09:59:23] a great mindset...
[09:59:24] Can I win you come to KSA?
[09:59:27] ...and a great day.
[09:59:29] And please, Lord, let me complete this game.
[09:59:32] Amen." Yo Kai just wanted to say that
[09:59:36] you've really helped me through some times and I wanted to thank you!
[09:59:40] Also chat spam one if you think Kai a good person, peace!
[09:59:44] Also good luck with Elden Ring.
[09:59:46] Thank you bro no problem buddy. Thanks man.
[10:00:09] Yeah sleep tight kai baby what my dad doesn't understand English so can you say happy birthday in Arabic? Just say ala gaba. Ala Gaba
[10:00:17] Beacon and eggs or pancakes? Ayo when you go to the zoo, do the zookeepers try to put you back in the ape enclosure?
[10:00:30] What does that mean chat?
[10:00:33] We will be blowing up new animals. What does that mean, chat?
[10:00:38] We will be blowing up New York City if you do not beat the DLC.
[10:00:44] A la garpa! Take high-five. Alagappa!
[10:00:47] Hey hi baby, hope you sleep well tonight sweetheart.
[10:00:52] Alagappa...
[10:00:57] Alagappa... Bro? I look godforsake. Bro, your trailer was dope. Keep up the hustle.
[10:01:01] Love from Australia. Thanks buddy! Thanks, buddy.
[10:01:09] Kai, can you tell my wife Janet to get off my body
[10:01:12] while I'm locked in on the stream she be bugging?
[10:01:17] Chill, bro.
[10:01:20] Are you close to beating the game?
[10:01:27] Yeah! One more boss.
[10:01:29] Bro, you got motion in Dubai and the Philippines.
[10:01:33] Come visit, bro. Please look up Samuel Nahorn on IK.
[10:01:37] He makes crazy beats, free for you.
[10:01:42] I'm back!
[10:01:43] Hi when are you coming to Amman Jordan?
[10:01:48] I don't know yet... Oh, not yet. Buying your bozo bum Rn.
[10:02:04] You better get some rest, I heard the final boss in Elden Ring is Lizard.
[10:02:09] RIP in the chat 69 kai I'll beat that boss for the 100k. I said sleep well, Kai baby. Driving cars that burn gasoline and making electricity by burning coal and gas releases carbon dioxide and other greenhouse gases
[10:02:55] into the atmosphere. Curing
[10:02:57] of cement emits carbon dioxide,
[10:02:59] too. Our landfills
[10:03:01] and farm animals also cause
[10:03:03] greenhouse gas emissions. Since the late 19th century, when factories
[10:03:07] powered by coal became common, the amount of carbon dioxide released into the atmosphere
[10:03:13] each year has increased. Also get post malone on stream he the nicest artist you
[10:03:18] meet yeah i'm supposed to go below my money don't jingle jangle it folds
[10:03:32] i love you kai heart just know you are the best my heart.
[10:03:36] Heart, heart, heart, heart.
[10:03:42] Love you too bro.
[10:03:45] Yo Kai stop texting my baby mama before I beat your ass.
[10:03:48] I have to bro!
[10:03:55] You should've some cookies and milk and rest Kai.
[10:04:05] Love the movie of a trailer. Love from Seattle, Washington
[10:04:11] Love bro
[10:04:15] Tick twister Mr Blister
[10:04:17] Deadly Twister on Daddy's Fistister sister was fisted by mr. Magister on testosterone zester fist me please heart chi
[10:04:28] Pop out to Seattle with Amp.
[10:04:40] So anyway as I was saying she's 21 beautiful and she can cook woomyow.
[10:04:48] Can I order some MAMP merch for my birthday but put in the wrong address like a dumbass what do order number 2255 plaza help, crying face love from Kuwait If everyone in AMP were not allowed to stop playing and streaming, who would finish Elden Ring plus the DLC first?
[10:05:23] And what would the leaderboard look like?
[10:05:26] I'll finish the next one first.
[10:05:29] We friends too. You're close to finishing Elden Ring, but him closer to to coming please fiddle with it.
[10:05:50] Appreciate the content and good vibes bro, always spreading the good energy.
[10:05:56] P.S stop saying words from other languages, they tryna trap
[10:06:00] you lol
[10:06:04] Hi Kai this is Telekineser a a fellow Treenies streamer just wanted to say that you inspire me a lot. You are so humble and kind thank you less than 3
[10:06:13] No problem no skeet
[10:06:15] How many bits for you to sleep in a G string?
[10:06:25] Kai, you need to go to any Arabic country. You have fans there too.
[10:06:37] That's why your short and you get no bitches.
[10:06:41] Fuck you bitch!
[10:06:47] You are my sunshine, my only sunshine.
[10:06:51] You make me happy when skies are grey you'll never know.
[10:06:54] Dear how much I love you please don't take my sunshine away the other night.
[10:06:58] Dear as I lay sleeping I dreamed I held you in my arms Please don't take my sunshine away the other night.
[10:06:59] Dear as I lay sleeping,
[10:07:00] I dreamed I held you in my arms when I awoke.
[10:07:03] Dear I was mistaken so I hung my head and cried
[10:07:06] You're my sunshine
[10:07:07] My only sunshine
[10:07:08] You make me happy
[10:07:09] When skies are grey you'll never know dear how much i love you please don't take my sunshine away
[10:07:18] When's the next triad?
[10:07:27] Jesus loves you all. So when you waking up, I say five hours from now also good night can you save air on top it's
[10:08:01] my friend group.
[10:08:12] What zoo is this streaming at?
[10:08:22] I'm using my vibrator on you, buddy. um Let me out! Mmmmmmmm...
[10:08:57] Let me help!
[10:09:03] Can I tell them to follow Psy underscore Sot so he can reach affiliate. Praying gesture.
[10:09:15] It's all over the screen.
[10:09:28] Baby I just don't get it do you enjoy being hurt?
[10:09:28] I know you smell the perfume, the makeup on your shirt.
[10:09:32] You don't believe in stories man, you're getting all lies!
[10:09:35] Yo Kai good sleep and coon sarshy ow.
[10:09:48] Can you say happy birthday I'm from Australia bro big fan my girlfriend hates me up late watching you if you said happy birthday would make my year.
[10:10:00] Is Kevin coming back on stream?
[10:10:03] We don't know.
[10:10:09] I'm over here, I'm stroking my dick.
[10:10:12] I got lotion on my dick.
[10:10:13] I am just stroking my shit.
[10:10:21] What you know about rolling down in the deep? When your brain goes numb,
[10:10:25] You can call that mental freeze when these people talk too much. Put that shit in slow motion
[10:10:31] Yeah I feel like an astronaut in the ocean
[10:10:33] eh what do you know about rolling down
[10:10:35] in the deep? When your brain goes
[10:10:37] numb, you can call that mental
[10:10:39] freeze when these people talk too much
[10:10:41] put that shit in slow motion.
[10:10:44] Yeah, I feel like an astronaut
[10:10:45] in the ocean she say
[10:10:47] that I'm cool.
[10:10:48] Damn straight.
[10:10:51] Kai can you turn
[10:10:52] the lights off
[10:10:53] him trying to sleep?
[10:10:55] Nah.
[10:11:00] I'm not gonna turn it on!
[10:11:03] The ATP-adenos fundamental biochemical mechanism through which cells
[10:11:10] generate energy.
[10:11:12] In eukaryotic cells, this primarily occurs through cellular respiration, which includes glycolysis
[10:11:18] , Krebs cycle and oxidative phosphorylation.
[10:11:24] Glycolysis, in the cytoplasm, breaks down glucose pyruvate, producing a small of
[10:11:30] glycolysis is a central metabolic pathway that converts glucose into pyvate, yielding energy in the form.
[10:11:40] Kai tips to getting over a breakup of 11 months at 19?
[10:11:48] Uggghhh... Oh! I won you getting a new chair.
[10:11:56] I never want your family.
[10:12:01] Hi Kai, I hope you're having a great evening.
[10:12:03] I just wanted to ask...
[10:12:05] What is your opinion on ducks dressing up?
[10:12:08] Do you think ducks should quack or bark instead?
[10:12:11] Why do we treat ducks like they're lesser than us?
[10:12:14] Anyways go to bed now my Sigma Chi Senate,
[10:12:16] Or you will have to hide because my Alpha Sussy big balls are coming for you right now.
[10:12:21] Emphasis on the coming.
[10:12:26] Text message from Elizo, hey Kai when are you gonna let me sit on your face?
[10:12:36] Her laughter's for another.
[10:12:38] Her motions are disguised her makeup doesn't cover what i see behind
[10:12:42] her eyes yes i know that nothing's wrong but what's the harm in asking why
[10:12:47] i know that you're not tired where the fuck were you tonight?
[10:12:53] Aloha from Hawaii.
[10:12:56] Hit me up when you come down here.
[10:12:59] My hubby watches you all the time, hee-hee.
[10:13:02] Can you say hi Shaden?
[10:13:04] Hi Shaden!
[10:13:07] Hello Kai, I am the one who trapped you into speaking Arabic.
[10:13:11] I would like to take this chance to apologize
[10:13:13] To absolutely nobody. Na na loki sorry had to be done
[10:13:21] Global announcement chat, the user Akavali is a fucking bitch and he needs to get thrown in a trash can.
[10:13:27] Everybody make fun of this loser!
[10:13:33] Was 5k for the pussy worth it?
[10:13:39] Hey, hey bitch! That shit wasn't fucking true dumbass.
[10:13:44] I could help you get a good weapon set up. That shit was in fucking tube, dumbass!
[10:13:46] I could help you get a good weapon set up.
[10:13:53] The fuck do I want with y'all niggas man? Kai, I love you bro- The best stream gang hope you beat Elden Ring. Love you Kai
[10:14:05] What's the most gifted subs you ever got I don't know, I'm gonna text the chef for tomorrow.
[10:14:09] I don't know if I forgot it's a lot though...
[10:14:11] Probably like...
[10:14:12] A thousand and...
[10:14:14] Two hundred?
[10:14:16] Yo Kai when you g gonna do Life is Strange gameplay and also keep-keep that mouth open
[10:14:21] I'm almost finished and now I know where to aim.
[10:14:31] Don't worry, I will watch you sleep all night my little pookie.
[10:14:54] God is good. Kai's neck, Kai's back, Kai stays smoking Radon's pack.
[10:14:58] He won't ever beat the game cause Radon stays schooling this lame. He blowing Kai's back he got him bending all the way
[10:15:02] back licking the ball ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha.
[10:15:13] Here you go, eh?
[10:15:14] Hiya, goodnight!
[10:15:16] Hey Kai how can we connect my name is Waylet's journey on all platforms.
[10:15:25] Tell me a price! From your Afghan Habibi I'll fly and pay my own way!
[10:15:36] Yo KC3 inverted exclamation mark inverted exclamation mark inverted exclamation mark inverted exclamation mark inverted exclamation mark inverted exclamation mark inverted exclamation mark inverted exclamation mark inverted exclamation mark inverted exclamation mark inverted
[10:15:56] exclamation mark inverted exclamation mark inverted exclamation mark inverted
[10:16:02] exclamation mark inverted exclamation mark I have received were that you
[10:16:15] Acting something you ain't let me
[10:16:17] Remind you you are five foot
[10:16:19] One and built like a potato
[10:16:21] Come to my block
[10:16:23] And I'll hit you like pee pee pee Pppppp And from the back like tshhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhthhth with soy soy soy soy soy soy soy good night kc3 come to stockholm sweden do you vaseline Text message from Elizo, Kai can I sit on you? Starting a YouTube channel put me on game that could increase views and getting my channel in the search engine.
[10:17:23] Kai can you tell the chat to follow my friend with speech all need he is trying
[10:17:27] to be the world's first professional ball fondler.
[10:17:32] String bean, chili bean, vanilla bean jar of creatine headace. Yohkai you built like a Chipotle veggie burrito and Lokea gorilla could handle them sticks on Elden Ring better than you, maybe you could beat the game.
[10:17:59] Sigma-Sigman on the wall who will be the scaryibbidiest of them all? Sigma-Sigma on the wall
[10:18:12] who will be the skibbidiest of them all?
[10:18:18] Can you share your experience
[10:18:20] of becoming successful like the ups and down,
[10:18:23] And what keeps you going?
[10:18:30] Hi my friend Rachel Poon-Tang also hold still im almost finished can you say hi to her for me?
[10:18:40] Drake or Kendrick? Tyler Warice Spies out t I said right foot creep, ooh, I'm walking with that heater look around, stay low, make
[10:19:23] sure they don't see you catch em bad, walk down
[10:19:26] face them with that heat of the devil under your feet. You're on your way to
[10:19:30] see him let's go stretch me one i can't sleep
[10:19:33] bang out when I see you play with me, You can't sleep.
[10:19:36] We gun in to decease you, You won't have no case.
[10:19:39] Rearrange your shape soon as they face you,
[10:19:41] You won't have no space.
[10:19:43] We in your section till we spray you.
[10:19:49] Kai fell for Tyler's charm instantly, but every attempt to move closer rendered in frustration.
[10:19:56] Tyler adored Kai's company but never saw him as more than a friend.
[10:19:59] Kai's subtle advances were met with laughter and gentle pats on the back.
[10:20:04] One evening, after a heartfelt confession,
[10:20:07] Tyler smiled warmly.
[10:20:08] You're like a brother to me, Kai.
[10:20:10] Kai sighed, masking his disappointment with a grin.
[10:20:14] Friend-zoned and blue-balled,
[10:20:16] Kai decided their friendship was worth more than unreciprocated love.
[10:20:24] Kai this is the sound of me flicking those fat lips.
[10:20:38] Pokimane says, Hi Kai, sending hate from planet Mars. You will never beat the game lil nigger, get good hahaha I'm so rich.
[10:20:49] Hey Kai I got to say you're pretty fucking good at the game for only playing for a few months and what type of weapon are you trying to use? Make me sweat, make me hotter, make me lose my breath.
[10:21:04] Make me water, make me sweat, make me hotter,
[10:21:07] make me lose my breath.
[10:21:09] Make me hotter, make me lose my breath. Make me water.
[10:21:16] Goodnight Kai!
[10:21:43] Now I... oh sleep well we friends too?
[10:21:51] You got bedbugs the bed, gang.
[10:22:05] Let me nibble on your ear while you sleep.
[10:22:15] Hey Kai, long time fan here. Really been enjoying the Elden Ring run the last few days and just wanted to say L underscore L underscore L underscore L underscore, L underscore, L underscore score Coelanthus, coelanthus, coelanthus, coelanthus... L underscore L underscore L underscore
[10:23:05] Ki the type of nigger to pay for pussy pussy
[10:23:23] sunflower Sunflower, sunflower, sunflower, sunflower, sunflower, sunflower You are my sunshine, my only sunshine
[10:23:26] BTKT BTKT BTKT BTKT BT KT BT KT BT KT BT KT
[10:23:34] Sunflower, sunflower, sunflower, sunflower, sunflower.
[10:23:48] Kai what type of weapons are you wanting to use for that boss fight.
[10:23:56] Hello my lego boy how are you long time no see oh, I need to sneeze. Ah, chup!
[10:24:13] Kai, SZA said she beat Radon and she offered to summon for you. Do you want to accept?
[10:24:18] Right Magnifying glass right magnifying glass
[10:24:36] right magnifying glass right magnifying glass
[10:24:39] right
[10:24:44] please forgive me i accidentally said um Imma be honest it was a nick not a mistake but sorry
[10:25:30] Y'all niggers so damn annoying, shut the hell up. Kai, I found the fragments and have a tutorial. Oh no kaisenot. The results are in! Printing your game as stats?
[10:26:33] Just what we thought. You are definitely asscheeks at this game. Am I tripping or this guy is so nnnn? in Good night, K-H-A-H-A-H-A-H-A-H-A-H-A-H-A-H-A-H A bomb has been planted. hmm Sonny Prawley
[10:26:35] give crazy head
[10:26:48] hmm niggas stop saying nigga it's making me angry pouting face Pouting face, pouting face, pouting face, pouting face,
[10:27:28] pouting face, pouting face, pouting face, pouting face, pa- so sunny is smoking his meat while he's watching. Should check on him. Bromide sprinklers just came on and sounded like this. It came back like... Hi, why am I low-key going to you right now? so.. I'm going to heat up some fried chicken. NANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANAN skfr skfr um..... Hi, please wake up or no. one......... Kai, my sweet prince. Get that beauty sleep you so deserve. As I observe you wrapped in your black blanket,
[10:33:08] I can only hope you are having
[10:33:10] a wonderful dream. A dream
[10:33:12] where you have everything you ever wanted.
[10:33:15] Love you.
[10:33:19] Promised consort radar love you promised consult radar and promise to consult radar and promise to consult
[10:33:22] radar and promise to consult radar and promise
[10:33:26] to consult radar and promise to consult radar and promise to consult Unpromised Radon promised Consult radar, unpromised. Consult radar, unpromised. Consult radar, unpromised. Consult radar, unpromised. Consult radar.
[10:33:58] Hi watch out there's a spider on the bed.
[10:34:07] Kai fell for Ruby Rose, mesmerized by her beauty.
[10:34:12] However, Druski, fiercely protective of Rudy, discovered Kai's feelings.
[10:34:18] Enraged, Druski confronted Kai.
[10:34:21] The confrontation escalated and Druski confronted Kai. The confrontation escalated, and Druski's anger turned physical.
[10:34:26] Kai found himself overpowered and humiliated, enduring Druski's aggression.
[10:34:31] Druski didn't stop until Kai was left broken, having endured backshots in the painful encounter.
[10:34:36] Kai's feelings for Ruby were overshadowed by the fear and pain inflicted by Druski........ I'm sorry.
[10:36:20] Imagine Melina just came to life and started fucking Kai like mm, mm, mm, mm, mm
[10:36:23] MM
[10:36:24] MM
[10:36:25] MM
[10:36:26] MM
[10:36:27] MM
[10:36:28] MMM
[10:36:29] R mm mm........ Type 1 in the chat if I should fuck Kai like this some............ Chat, how many deaths did it take Kai to beat Rolando? I need to know if he's doing better than me or Mei.
[10:40:28] Hi sleeping like he just took 100 backshots like this and...
[10:40:33] Hmm? Hmm? Hmm? like this and. so.. so. so so. Hi Pluck Mike
[10:42:29] Webbs Kai please wake up, you're turning into the lion from Eldon Ring........ so. so...... chat does he betrayed on tomorrow type 1 if yes 2 if no?....
[10:46:21] Mmmmm... Mmmmmm...
[10:46:23] Mmmmmmm...
[10:46:25] Sunny stop watching purple sleeping and get a life 77 do you quadragentillion 777 on quadragentillion 777 quadragentillion 777 novemberagentillion 777 November, 777 October, 777................ I've been using my rose toy on myself and just found out a new setting listen listen fuck
[10:49:51] fuck
[10:49:55] fuck yes
[10:49:59] oh my god, I'm gonna...
[10:50:04] Come.
[10:50:06] Wow that was a good sesh thank you Kai I can sleep now......... so.... 40,000 people watching a grown man sleep is crazy.. You are one of the 40,000 weird ass nigger..... Bro calm down we know you enjoying this sausage fest of a chat..... okay. uh........... Nigger, I know you ain't sleeping. I'm going to be shot by a machine gun. is Chant oh my god kai my ass can't take it don't stop yes right then I'm going to come fuck yes more more, nervous sweat, nervous sweat, nervous sweat, nervous sweat, nervous sweat, nervous sweat, nervous sweat, nervous sweat Nervous sweat Never sweat, never sweat, never sweat, never sweat, never sweat, never sweat, never sweat, never sweat, never sweat, never sweat, no nervous sweat....... so.................................
[11:06:27] Kai the Puss cannot take it. Nnnn...
[11:06:29] Deeper? Fuck nnnn
[11:06:31] Yes right there, nnn. Are you too deep in me? Unleash!........ Okay. so.. I don't trust people that aren't sleeping naked and fart in bed.
[11:09:07] Show us where you fart from! um....... Who's shitting my pants?............ 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20. 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30. 4 5ths, stst. 1 10th, stst. 5 8ths, 5 6ths, stst. 1 tenths Stst 5 eighths
[11:13:39] 5 sixths
[11:13:40] Stst
[11:13:41] Care of
[11:13:42] St 17
[11:13:43] Dot
[11:13:44] Inverted
[11:13:45] Exclamation mark
[11:13:46] Inverted
[11:13:47] Exclamation mark
[11:13:48] Inverted
[11:13:49] Exclamation mark Inverted Exclamation mark, inverted exclamation mark Mark Inverti-Exclamation Exclamation mark inverted exclamation mark inverted exclamation mark inverted exclamation mark inverted exclamation mark inverted exclamation mark inverted exclamation mark inverted exclamation mark invert
[11:14:34] Wake up or you're gay so so so... semicolon inverted question mark inverted question mark inverted question
[11:15:56] mark inverted question mark inverted question mark inverted question mark inverted question mark inverted
[11:16:00] question mark. Hold these back shots are cute. so so so Inverted question mark, inverted question mark, inverted question mark, inverted question
[11:17:16] mark, inverted question mark, inverted question mark, inverted question mark inverted question mark inverted question mark inverted question
[11:17:24] mark inverted question mark inverted question mark inverted question mark
[11:17:28] inverted question mark inverted question mark inverted question mark
[11:17:32] inverted question mark inverted question mark inverted question mark inverted question mark inverted question mark inverted
[11:17:46] question mark inverted question mark inverted question mark inverted
[11:17:51] question mark inverted question mark inverted question mark inverted question mark
[11:17:57] inverted question mark inverted question mark inverted
[11:18:01] question mark inverted question mark inverted
[11:18:04] question mark inverted question mark inverted question mark inverted question
[11:18:08] mark inverted question mark inverted question mark inverted
[11:18:13] question mark inverted question mark inverted question mark inverted question mark inverted question mark inverted
[11:18:29] question mark inverted question mark inverted question mark inverted
[11:18:33] question mark inverted question mark so so....... I'm going to go ahead and start the recording. um um um chicken... But we friends though........... I stopped my throat.
[11:24:14] I told you to stop please. I am going to gag it is too big.
[11:24:23] Oh no, this is what I need. bomb has been planted hmm
[11:24:50] bomb has been defused.......... Bye bye. Thanks. Don't you just hate it when your cat wakes you up like this?
[11:27:12] Meow Meow. Meow. Meow.
[11:27:20] Meow.
[11:27:21] Meow.
[11:27:22] Meow.
[11:27:23] Meow.
[11:27:24] Meow.
[11:27:25] Go go go!
[11:27:26] Meow.
[11:27:27] Meow.
[11:27:28] Meow.
[11:27:29] Meow.
[11:27:30] Meow. Meow. Meow. meow meow meow meow meow..... But we friends though, bitch.
[11:28:53] Hope you're ready for Radon to clap them cheeks again today.
[11:29:05] Rogia said you are 2486...... me Shka-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya-ya The
[11:30:57] The How you spin it, who gets the right to defend and who gets the art of resistance has always
[11:31:09] been bout dollars and a color over pigment.
[11:31:12] But white supremacists finally on blast screamin' free for last team till their home at
[11:31:17] last we see the lies in and claiming it's anti-semitic to be anti Zionist I've
[11:31:23] seen Jewish brothers and sisters out there and riding in solidarity and
[11:31:27] screamin' Free Faulstein.
[11:31:33] Bro gonna wake up just to get cooked on the game all day..... Wakey wakey hands off snakey kai get up.... His palms are sweaty, knees weak, arms are heavy there's vomit on his sweater
[11:33:35] already. Mom spaghetti
[11:33:37] he's nervous but on the surface
[11:33:39] he looks calm and ready to drop bombs
[11:33:41] But he keeps on forgetting what
[11:33:43] he wrote down. The whole crowd goes so loud,
[11:33:46] He opens his mouth
[11:33:47] But the words won't come out
[11:33:48] He's choking
[11:33:49] How everybody is joking
[11:33:51] Now the clock's run out
[11:33:52] Time's up over
[11:33:54] Blow snap back to reality
[11:33:55] Oh there goes gravity oh there goes rabbit
[11:33:58] He choked he's so mad but he Is Kai bricked?.. Car uses a step stool to get into bead....... I'll donate 10,000 bits if you get up and start twerking..... In white but half latino plus mafia boss level 100, can I say nigger?
[11:37:08] Cat pls cat pls cat pls cat pls cat pls cat time cat time cat time cat time cat kiss.
[11:37:22] Free-free-free for lasting from genocide Joe Israel gets free healthcare and college
[11:37:25] While Americans pay for it
[11:37:27] Stop the tax, stop the hate
[11:37:28] Free for lasting They their bombing kids and women
[11:37:31] and wrapping the women and imprisoning the men................ I'm too sexy for my love, too sexy for my love, love's going to leave me.
[11:40:25] I am too sexy for my shirt, too sexy for my shirt so sexy it hurts and I'm too sexy for Milan, too sexy for my shirt so sexy it hurts and I'm
[11:40:30] too sexy for Milan, too sexy for Milan
[11:40:33] New York & Japan and I am too sexy for your party
[11:40:36] too sexy for your party no way I'm disco dancing
[11:40:39] I'm a model.
[11:40:43] You know what I mean and I do my little turn on the catwalk.
[11:40:46] Yeah, on the catwalk, on the catwalk.
[11:40:49] Yeah, I do my little turn on the catwalk.
[11:50:53] I'm too sexy for my car, too sexy for my car......... Bill Cosby pickup lines be like what pickup line works each time? Excuse me, does this rag smell like chloroform to you........... But we just friends to, but we just friends to, but we just friends to, but we're just friends too, but we're just friends too, but we're just friends too, but we're just friends too, but we're just friends too. Wake up, Big Zixanti!................. The horn on the bus goes beep, beep, beep. be paid.......... My sprinkler goes like this. And comes back like
[11:51:00] Don't you just hate it when your cat wakes you up
[11:51:06] like this. Meow, meow
[11:51:09] meow, meow, meow, meow, meow, meow, meow, meow, meow.
[11:51:16] Don't you just hate it when your dog wakes you up like this?
[11:51:20] Woof! Woof! Woof! when your dog wakes you up like this.
[11:51:22] Woof, woof, woof,
[11:51:24] woof, woof,
[11:51:26] woof, woof,
[11:51:27] woof, woof,
[11:51:28] woof. Chat Spanish or English? chat spanish or english whoever types is gay...... Moon viewing ceremony Moon viewing ceremony.. But we friend so but we friend so but we friend so but we friend so but we friend
[11:53:59] Chat whoever is from Somalia, tell em this now Abba Hoda Bada Vaza alrighted manus I love you.
[11:54:06] Alalalalala la la Moon viewing ceremony moon viewing
[11:54:32] ceremony moon viewing ceremony moon viewing
[11:54:36] ceremony moon viewing ceremony moon viewing
[11:54:39] ceremony moon viewing ceremony moon viewing
[11:54:42] ceremony moon viewing ceremony..................... Moon viewing ceremony moon viewing ceremony moon viewing ceremony
[11:59:11] moon viewing ceremony moon viewing ceremony
[11:59:14] moon viewing ceremony moon viewing ceremony
[11:59:18] moon viewing ceremony moon viewing ceremony moon viewing ceremony.. But we friends, Tokai. But we friends Tokai but we friends Toe but we friends Toe but we friends Tokai but we friends Toe but we friends Toe but we friends Tokai but we friends Toe but we friends Tokai are so sexy when you sleep nigger... Moon viewing ceremony, moon viewing ceremony,
[12:01:00] moon viewing ceremony, moon viewing ceremony,
[12:01:05] moon viewing ceremony moon viewing ceremony moon viewing ceremony
[12:01:20] moon viewing ceremony moon viewing ceremony.... Yo Kai, I just wanna say you inspired me so much I'm in a wheelchair and you made me happy when i was down
[12:02:26] So today, I finally got out of my wheelchair and started walking to turn your stupid shitty ass stream off.
[12:02:38] Cess so so................................. so..... um.......... Kai, can I sleep next to you goddamn?............... I'm sorry. LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllll I don't know. go go go down oh well um now LL, LL, LL, LL, LL, LL, LL, LL.
[12:16:33] IS Kaki Ah yes, can I keep her face up? I am almost there.......... My mom came over today and I was like, Mother, aye. Mother,
[12:18:32] aye.
[12:18:33] Mother R,
[12:18:34] wait a second,
[12:18:36] that's that one record where you say
[12:18:36] you got molested
[12:18:37] or fuck me arges?
[12:18:42] Wake up ass ass-up!
[12:18:51] Maybe he is asleep W-W-W-W-W-W-W-W-W-W-W-W-W-W-W-W-W-W-W ww www W-W-W-W-W www W-W-W-W-W-W-W-W-W-W-W-W-W-W-W-W-W-W-W-W-W-W-W-W-W-W-W-W-W-W-W-W up I also forgot to tell you to oh oh um down now now down so go Maybe he is asleep.
[12:22:25] WWWWW maybe he is asleep you w www.www.ww....... slash TTSA hey hey hey hey hey hey hey hey hey hey hey hey hey hey hey hey hey hey
[12:24:47] dan bend over very quick that giant..... Hello big fake sleeping hudda um I forgot to LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllll down... Someone Someone hold his face up I am almost there and also bend the task too just like that.... There was a phrase that struck a chord and took the internet by storm.
[12:28:12] A phrase when she's spitting right onto you.
[12:28:15] A dude said,
[12:28:16] I'm not gonna let you do this to me.
[12:28:18] I'll just go ahead and get my ass kicked out of here. internet by storm. A phrase when she's spitting right onto you. That dude said this to these
[12:28:22] two chicks, what always brings a man to bliss? And she said spit on that thang. Hark, to
[12:28:29] ya! it on the thing. Hark to you!............... Good morning, Kai............ Wow, what a sellout streamer. Do they let just anybody talk on this text-to-speech thing?
[12:33:37] Wow, you think you know a streamer and then next thing
[12:33:40] You know they start taking 200-bit text to speech donos
[12:33:44] Is this one of those get rich quick schemes?
[12:33:48] 200 bits at a time. Well I hope you're happy with yourself streamer. wow.. Hey chat. Wow!. Wake up, wake up, wake up, wake up, wake up, wake up, wake up, wake up, wake up, wake up,
[12:35:10] wake up, wakeoe, capo-...
[12:35:56] . Wow. Wow, so you're scared of the big BOSG-spush Syoxpy Bajarge Gshisp. Wow. Wow!... Wow. You just gonna lay there like that?
[12:37:32] Wow! Who made you like this?
[12:37:34] Wow! Sleeping when the sun is out?
[12:37:37] Wow!. We friends thlshpskfifusbukdys.
[12:38:13] My ropelcopter goes soy soy soy soy My rifle cocked at a size, size, size, size, size, size, size, size, size..... Wow, wow, wow, wow, wow just woman wow........... Do you think Kai wet's the bed?...... Hey Kai, this is your mother. I'm at home and I just got a call from Amazon about an order for an extra large vibrator. Did you mean to send it here? Or
[12:42:56] is there something I should know? Just sitting here with a mix of curiosity and confusion...
[12:43:02] Love, your bewildered momokai........ I can't wake up Black ass up boy. Don't let me come to your house and spank you like a little good boy as you are. Wake up right now I am sniffing your black ass. Wake up, we friends, too..... so..... Hello Kai. This is the Spooky Milkman. I am here for your nightly milk production session.
[12:47:13] As you have ordered the premium service for tonight, we will provide you with a wet nipple stimulation service to help your milk ducts get ready for extraction.
[12:47:22] Stay still now, this won't hurt a bit!. um um........ Okay Google, what is my address.. Wake up Kyle, I'm Tyler is here aye hey hey hey hey hey hey hey hey hey hey hey hey hey hey hey hey hey hey hey hey hey hey Ay, ay, ay, ay, ay, ay, ay.
[12:50:37] You know I do it big.
[12:50:39] Yeah, I do it big like ice in its head.
[12:50:42] Fire your freaking barber! I'm not gone freaking lie, fire your barber. If that barber really is your friend, he for real hating on you. Fire your barber fire your barber fire your barber, fire your barber, fire your barber.
[12:51:02] Hey! KU? Are you tired of being a grunt and you see a blue crown logo next to your name?
[12:51:09] That means you have Amazon Prime! With this logo next to your name it means you can subscribe up for the free ski.
[12:51:17] Wow!...... It looked like her cut your hair with some apple cider.
[12:52:44] Ha ha ha how the heck ha?
[12:52:46] It look like he cut your hair with a Buzz Lightyear action figure.
[12:52:50] Ha ha ha ha ha ha ha ha ha! I'm not sure what to do with this.
[12:53:57] Hawk, do you let me spit on the fang o' war?. How deep is the hole? There was a phrase that struck a chord and took the internet by storm.
[12:54:00] A phrase when she's spitting right onto you.
[12:54:05] A dude said this to these two chicks, what always brings a man to bliss? And she said spit on that thing. Hark, to you.... Jesus is King. Baby get the measuring tape, I think the girth increased a little bit.... W-W-W-W-W-W-W-W-W-W-W-W-W-W-W-W-W www up www
[12:56:42] hi looking cute rn i'm boo to act up
[12:56:53] i know those stinky farts under the cover smell good. a balloon I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you, I'll pull you in double in double in double in double in ww Wwwwww W-W-W-W-W-W-W-W-W-W-W-W-W-W-W-W-W-W-W-W-W-W-W-W-W-W-W-W-W-W-W www.www.www.......
[12:58:12] ...
[12:58:14] ...
[12:58:16] Whoever spammed all those
[12:58:18] damn W's should honestly
[12:58:20] shut the fuck up. I'm over here with my pants down
[12:58:22] trying to beat my shit like it's a
[12:58:24] motherfucking sport, and y'all got
[12:58:26] me listening to some crazy
[12:58:28] wwwww
[12:58:30] ww shit and it got me tweaking.
[12:58:33] Know what fuck this I'm finna go get a damn cupcake on God brah.
[12:58:37] Fucking wackass type shit spamming W's n' shits, literally just trying to get a nut off br fr fr fr fr Not my proudest nut, broken heart, toilet, toilet, toilet, toilet, toilet,
[12:59:05] toilet, toilet, toilet, toilet,
[12:59:09] toilet, toilet, toilet, toilet,
[12:59:13] toilet, toilet, toilet, toilet.
[12:59:19] Man why are you talking shit it's smooth to get wicked in here!
[12:59:23] Don't make me
[12:59:36] they not like us, they not like us. You think the bacon will let you disrespect Pac-Nigger and I'll spam wwwwwwww if i want to. Wake up now, I'm tired of hearing these people spam wwwwwwww like oh my gee.
[13:00:25] Are y'all gees good?
[13:00:27] I'm trying to backshot my Roblox-y girl.
[13:00:30] Oh shit, be right back! My homie wants some as well.
[13:00:34] WWWWWTUB
[13:01:09] **Ding** www did this do can i just have an orgasm on stream or am I tripping chat your chat you'll ever fart when you nut cause ngl just busted and it was nice Everyone shoot the flip up with the W stuff it's not funny at all not one bit IT makes me mad stop I pull you, I pull you, I pull you, I pull you, I pull you, I pull you, I pull you, I pull you match stopped www W-W-W-W-W-W-W I'll fill you, I'll fill you, I'll fill you, I'll fill you, I'll fill you, I'll fill you,
[13:01:44] I'll fill you, I'll fill you, I'll fill you up.
[13:01:50] Can you spread the message that the Drake video was actually my dad?
[13:01:54] So everyone knows the meat genes live in me. Toilet toilet
[13:01:58] toilet toilet toilet toilet
[13:02:03] The snow blows white on the mountain tonight not a footprint to be seen
[13:02:07] A kingdom of isolation and it looks like I'm the queen
[13:02:10] The wind is howling like this swirling storm inside couldn't keep it in
[13:02:14] Heaven knows I tried don't let them in
[13:02:17] Don't let them see be the good girl you always have to be conceal
[13:02:21] Don't feel, don't let them know well now they know let it go
[13:02:25] Let it go can't hold it back anymore let it go, let it go can't hold it back anymore
[13:02:28] Let it go, let it go turn away and slam the door I don't care
[13:02:36] W-W-W-W-W-W-W-W-W-W-W-W-W-W-W-W-W
[13:02:56] Okay, oh my god bro
[13:02:57] My pants are still down
[13:02:58] And I'm still trying to beat it like a sport, but who remembers ep 445 frfr. Like whatever happened to that bro.
[13:03:08] I kinda miss waking up to hear how bad his
[13:03:10] explosive diarrhea was from Chipotle
[13:03:13] or how hard he beat his shit
[13:03:14] to the point that he had calluses
[13:03:16] NGL man, he was kinda my
[13:03:18] idol. It would be a shame if some Chris Hansen type shit happened between
[13:03:23] him and a cupcake on god. Yeah know what I think we should just spam it peed peed peed
[13:03:28] peed peed peed peed
[13:03:36] I will kiss you baby eeeeee
[13:03:45] Nuts are gonna drag on your face whilst you sleep, quick click P. Diddy is coming to tap you up You saucy little thing you sexy little chocolate marshmallow I'll kiss you on the forehead baby don't you stress
[13:03:51] Hey Baby Kai I really love that forehead
[13:03:53] I want to lick it and run away like my dad did to me baby cakes
[13:03:57] The boogeyman is under your bed
[13:03:59] And he's gonna touch your taint with his tongue
[13:04:01] You saucy little baby girl.
[13:04:10] Honestly if I hear another double of the U,
[13:04:13] I will pull my pants down and
[13:04:14] shit down my skibbity toilet.
[13:04:17] Let me hear you say OVDick.
[13:04:21] This dude got 30k
[13:04:23] viewers while sleeping shit crazy poop, poop, poop, poop, poop, poop, poop
[13:06:44] Oh Vote Kai for the Kids Choice Awards and also, Toilet, Toilet, Toilet, Toilet, Toilet, Toilet, toilet toilet toilet toilet toilet toilet toilet toilet toilet toilet toilet toilet. Hello, Kai Senate, it is me your only viewer. The whole time I have been creating the illusion you streamed to thousands of people when it was really just me. And now to prove this is true I will send the message but from all my accounts................
[13:06:46] ...
[13:06:48] ...
[13:06:50] ...
[13:06:52] Okay, so I just finished beating my fucking meat and I just wanted to say that this post-fucking-nut clarity is actually going so hard right now.
[13:07:02] The only problem is that I forgot I didn't have any toilet paper so the shit
[13:07:07] I just plastered all over the fucking bowl that kinda had some backsplashes honestly
[13:07:11] pissing me the fuck off, anyone got some recommendations oh now LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllll your ass up and beat, rather than 10 and um LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllll Kai, we all saw you hard stick when you sat right beside Kevin Hart. You were a bit excited there weren't you? I don't blame you, he is such a sexy pooky bear. I know he's short, but that's really an advantage to get that yummy stuff.
[13:09:05] MMMHMMMMM um. and NANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANANAN Hi, how are you still asleep after all this LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllll W-W-W-W-W-W-W-W
[13:10:08] Just to fuck up my 8 inch dick is nothing right now.
[13:10:15] 2 plus 2 is 4 minus 1 that's 3. Quick maths everyday man's on the block smoke trees, ah see your girl in the park that girl is work as when the ting went quack qu quack, quack you man were ducking. You
[13:10:28] man ducked! Hold tight ass knee my brother he's got
[13:10:32] the pumpy big ting hold tight my man my guy
[13:10:36] he's got the frisbee show. I'm Jibbiten by Oginjinkji on Igby, Jin here on Shinboy, Jinbunch Bean by Geoane, Beatupchit, Tehion, Hyoween here, Jot and Hatchahain. how jahane
[13:11:08] make me sweat make me hot, make me lose my breath
[13:11:10] Make me water normally I can keep my cool
[13:11:13] But tonight I'm wild and I may be in a dangerous mood
[13:11:17] Can match my timing telling me that you really bout it why try hide it talk is cheap
[13:11:23] show me that you understand how i like it can you blow my mind set off my whole body if i give you
[13:11:29] my time. oh way cut Ah ah ah ah ah ah ah ah ah ah ah ah ah ah ah wake up bitch!
[13:12:08] Speed said he beat it Elden Ring in just four hours. You think that's true. Guys, I am under case blanket right now giving his head.
[13:12:28] In the size of a hamster so that gives me an advantage since his stick is so freaking small, but for my mouth it's so freaking big like oh my gosh.
[13:12:41] You guys are so missing out on this incredible feeling.
[13:12:45] Yummy!
[13:12:50] I just want to say that we run this fucking chat now, brah.
[13:12:54] On god we got LLLLs on one side and W's
[13:12:58] on the other side. The only person that is missing from this equation
[13:13:02] is whatsup motherfuckers it's eat dat pussy 445 coming at ya with another bomb ass vid. But first I just wanted to
[13:13:10] say that I just got done beating my shit so fucking hard to Melania, ya feel me?
[13:13:15] Like she is so fucking bad on God brah. Anyway, everyone saw how you were looking
[13:13:21] at Kevin's whole bro.
[13:13:25] 10k bits if you stop faking................ This sleepy arnigar probably dreaming about Miklas sweet, sweet Empyrean boozee.
[13:16:11] Nigga sleeping like Radahn ain't already clapping those sweet cheeks like a jackhammer. Ooooooooh
[13:16:40] Wake up now Kai, I know you aim to sleep
[13:16:48] We friends We friends We are Friends T.H.O. so
[13:17:30] ifm your friend your family He a fan, he a fan, he a fan, he a fan, he a fan, he a freaky ass guy, he a 69 god freaky ass guy, he a 69 god hey, hey, hey, hey
[13:17:34] Run for your life
[13:17:35] Hey, hey, hey, hey
[13:17:37] Run for your life
[13:17:38] Freaky ass guy
[13:17:40] He a 69 God
[13:17:41] Freaky ass guy
[13:17:42] He a 69 God kia sky he has 69 god..... I'm not sure if this is the right way to do it, but I'll try.
[13:18:49] I don't know what's going on here...
[13:18:55] Just got done beating and creaming out my meat.
[13:18:59] Oh my goodness that felt so good!
[13:19:02] Those Roblox girls were so hot!
[13:19:04] Man...
[13:19:05] But anyways...
[13:19:06] Hi wake up!
[13:19:08] I am literally about to beat my meat again, and it's so sore. Help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help help llllcEVVVVVVVVVVVVVVVVVVV LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllll 483 Quintillion 828 Quadrillion 483 Trillion 728 Billion 288 Million 373 Thousand Seven Hundred 88,373,737 LLLL we find some 960837 837,382 quadrillion
[13:19:56] 838,382 billion
[13:20:02] 828 million 382,828,382,828 bitch ain't beating Elden Ring
[13:20:13] 92 sextillion eight hundred and It shamed beating Elden Ring 92 6,828,383,837,282,828,288,282 two hundred and eighty-two K I know the bitch you be linking in Connecticut gang. Some niggas in CT no lol. I'm going to bust Daddy Kai let me lick your little dirty armpits
[13:21:02] I'm so ready to cum in that taint little hole
[13:21:05] Kaya my lord I didn't know you were like this you and comes back like TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT 27 hours on Millenia, he's about to DP twice than that amount.
[13:21:52] This boss makes me go in the base game and call Starscourge Raidun an wimpy bitch.
[13:21:57] But for those wondering mo his meatless half-brother, the reet is up to you to speculate. uh uh Fandom is over, we tell- LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllll If you didn't wake up, you are gay. Gay gay gay gay
[13:22:53] Ski-ba dee riz
[13:22:54] GAY
[13:22:55] Gay like
[13:22:55] Moose
[13:22:56] Say gay
[13:22:56] Gay meek
[13:22:57] Meek
[13:22:57] Meek
[13:22:58] Lalalalala now soup okay um now LLLLLLLLLLLME BLEZD ON
[13:23:58] YOUR
[13:23:58] SSSSSSSSSSSSSSSSSSSSSSSS
[13:24:41] Bro let him sleep y'all kids so lame. I'm going to go back and read the chat. LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllll 828 6 282
[13:24:43] 828
[13:24:45] 828
[13:24:47] 282
[13:24:49] 828 Geovigentillion 2821 Vigentillion 828 Vigintillion 282 Nov Decilion 727 Octodecilion 272 septem decillion 727 sex
[13:25:17] decilion 272 quindecillian 782 quartuor decilian eight hundred and 782 ºC
[13:25:23] 828 ³
[13:25:26] 283 ºO
[13:25:29] 749 µS
[13:25:32] 910 ·C 749.910.182
[13:25:37] 0727.991
[13:25:41] 283 sextillion 737 quintillion 374 quadrillion 929 trillion
[13:25:52] 273 billion seven hundred,382,727
[13:26:03] Let me hear you say off-ho, off-ho Say off-ho, off-ho, say, off-ho, off-ho. Then step this way, step that way then step this way, step that way are you my friend? Are we locked in? Then step this way, step that in then step this way
[13:26:17] step that way then step this way step that way wake up you bronx rat you um like for those asking kai did reach second phase then got aborted and his corpse was picked apart
[13:27:12] And deported to Yugoslavia
[13:27:14] This boss is harder than Mesmer
[13:27:16] And Romania
[13:27:17] And Romania was insane.
[13:27:25] Can I wake up before I clap those nky cheeks?
[13:27:27] I'll throw you in the air and leave
[13:27:29] you there. Wake up now! Now I said, or I'm a slap those buns
[13:27:34] around. I diuresis as is Seguila diagnosis is is diuresis, cedula dioressus dioressis, cedula dioressus dioressssus dioresses, cedula dioressus
[13:29:11] dioressses, cedula dioressus dioressssus dioressssuss. diuresis I R S is, I R S is, sigillid diuresis dillard i am diuresis, diuresis, diuresis, cedula diuresis, diuresis, cedula diuresis,
[13:30:05] diuresis, diuresis, cedula diuresis, diuresis, cedulodiuresis, diuresis, diuresis, cedula diuresis, dioresis, dioresis, cedula dioresis, ioresis, cedula dioresis, ioressys, ioresses, cedula dioressis, ioressses IRISIS Diuresis is sedilla diuresis sedilla diuresis diuresis sedilidaerosis diuresis, gyrosis diarosis, cedula diarosis diers. is diuresis, sedila diuresis, dioresis, sedila diuresis, dioresis, dioresis, sedila diuresis,
[13:33:28] dioresis, sedila diuresis, dioresis, sedila diuresis, dioreseresis sedilla. Dieresis, dieresis sedilla.
[13:33:38] Yarl making bro money as he sleeps till 1pm that's fucking lit!
[13:33:44] Keep up the good work barrel kai!
[13:33:52] Go go gogogogoogogogogogog.
[13:34:12] My goodness, this is my 17th time busting already. I don't even think I have a dick anymore. I should be considered a female now all dickless like this.
[13:34:17] Thanks alot Kai.
[13:34:19] I had to entertain myself so much because of your selfish sleeping.
[13:34:23] Now i have to get plastic surgery to get extra huge triple x size tits.
[13:34:34] Hello chat I... um so so so so so I'm not sure if this is the right way to do it, but I'll try.
[13:35:46] Wake up my Elden Lord fucknigger! You must slay the tarnished a sap wake up now k Kiwi friend.
[13:36:04] 2838383
[13:36:06] 83837
[13:36:08] 3727
[13:36:10] 277
[13:36:12] 29919 2927 972-9191, 92927, 277384,
[13:36:18] 9199986283,
[13:36:22] 91, 92, 93, 73. eight six two eight three nine one nine two
[13:36:25] nine three seven three seven seven three eight two
[13:36:29] nine two nine three eighth e seventh e seven
[13:36:33] seventh the eighth e seventh e seventh e seven eight nine 7th, 8th, 9th, 9th, 9th, 9th, 9th, 9th, 382 938 388 3829 2927 3637 389 29928 373 747 829 287 eight three seven three seven four seven eight two nine two eight seven nine oh one
[13:36:59] oh one nine two seven three seven seven three nine one nine two seven three seven 1 9 2 7 3 7 4 8 4 8 4 8
[13:37:08] 9 2 9 2 8 3 7 4 8 4
[13:37:12] 18 19 10
[13:37:14] 9 3 8 3 7 4
[13:37:16] 7 70 for Octilia 800 8374774 Octillion 858 Septillion 483 Sextillion 838 Qu829.293.737.738.300 seven hundred and thirty-seven billion seven hundred and thirty eight million three
[13:37:41] hundred and ninety two thousand nine hundred and twenty eight
[13:37:56] kai you like the GLGLGLGLGLGLGLG oh yeah Kai call me them names oh yeah. Oh my god Kai it's so what GLGLglglglglglglglglglglglgl
[13:38:24] can i wake up please? This chat is losing brain cells and now they've reached Gen Z Brain Rotttide Pod Brain status. Bro hearing chat using TTS every morning makes me wanna fight consort Radon with no weapon.
[13:38:51] BBL Kizzy BBL Kizzy BBL Kizzy BBL Kizzy BBL Kizzy, BBL Kizzy, BBL Kizzy, BBL Kizzy, BBL Kizzy, Catherine. Fuck me Kai oh my god I wanna kiss you so bad oh kai your smelly little ass is what i need in my mouth.
[13:38:58] Wake up African booty scratcher diddy
[13:39:02] coming! African booty scratcher did he come in?
[13:39:13] Kai if you don't wake up, I will crawl up your smooth baby boy butt cheeks and lick lick licky-lick.
[13:39:17] You want that to happen?
[13:39:18] Oh wow!
[13:39:20] Okay, here goes nothing.
[13:39:23] OOOOOOOOOOOOOO oh oh Oh, oh, oh, oh, oh, oh, oh, oh, oh, oh, oh, oh, oh, oh, oh, wow.
[13:39:51] That really changed my life.
[13:39:53] That was so good.
[13:39:54] Thanks, my baby pookie baby boy baby baby baby oh boy English or Spanish? If you don't wake up your gay he just waiting for someone to speak back his butt clip with their tongue like a no no no so so txt so so so so xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
[13:42:09] Check do you think today's the day I beat Selden Ring?
[13:42:12] I don't think so niggas.
[13:42:13] S-s-s-s-s-s-s-s-s so um pow LL
[13:42:56] 1 sex for centillion, 928 quimver gentilian 748 quarter vigent alien 382 treviigintillion 939 Duovigintillion 293 Unvigintillion 892 Vigintillion 928 Novm decilion 383 Octodecilion 939 Septem decillion 292 sex decillion 828 quindecilion 382 quartuor dec decillion 827 3 decilion 373
[13:43:48] 0 decillian 839 non decillion
[13:43:53] 292
[13:43:55] decillion
[13:43:57] 929
[13:43:59] no million
[13:44:01] 282 octillion 837 Septillion
[13:44:06] 272 Sextillion 727 Quintillion
[13:44:13] 282 Quinthillion 827,282,828,887,872,828,282 It's time to me he he he.. I am very happy to meet you.
[13:45:33] I'm going to the you for your attention.
[13:45:42] I will be happy if you write me a letter in English.
[13:45:49] Thank you very much. I am Abba and copper who seated the issue of wellness to bar in family.. Kai, I told you that I can be a meanie weenie hot junior baby boy if you don't wake up.
[13:46:33] Gonna have to teach you a lesson now. Smacks his ass.
[13:46:36] You like that?
[13:46:37] Smacks his ass again.
[13:46:39] You like, like, like that? Oh wow!
[13:46:41] You actually like that? Well, here is more than.
[13:46:45] Oh yeah oh yeah oh yeah oh yeah oh yeah oh yeah oh yeah oh yeah oh yeah oh yeah oh yeah, oh yeah, oh yeah.
[13:46:54] Wow that really changed my perspective on you Kai!
[13:46:58] I didn't know you can be such an amazing baby boy!
[13:47:01] Mwah mwah!
[13:47:05] Daddy I'm always here for that little dirty booty my sexy little man kiss me again.
[13:49:25] Wow! Wow. Still sleeping? Yo-kai, the sun out. You getting up soon? Wow. Just wow...... Hello, Kai Diddy here. I'ma clap those tight-ass check real quick. so so Who let the dogs out? Woof, woof, woof, woof
[13:49:30] Woof, woof, wakey-y wakey kai.
[13:49:36] Whopper whopper bergerdoper. His whopper tastes just like dickhoppers, if I can just take a juicy bite ride along your back and take a hike.
[13:49:46] At B-Case. Have it your way!. Wow. I'm the one that upped the score with a walk him down, whole time i know he got some hoe in him pole on him, extort shit, bully, death throw on him say, drake, i hear you like em young you better not ever go to cell block one.. Certified lover boy? Certified pedophiles. Wop, wop, wop, wop, wop, dot, fuck em up, wop, wop, wop, wop, wop
[13:51:31] I'ma do my stuff while you trollin' like a bitch
[13:51:34] Ain't you tired?
[13:51:36] Trying to strike a chord and it's probably A minor... I'm sorry. Wop wop wop wop wop dot fucky em up.
[13:52:24] Wop wop wop wop I'ma do my stuff.
[13:52:27] Lol that's funny.
[13:52:29] Nice try daddy wait...
[13:52:31] No,
[13:52:32] I meant to say nice try diddy.
[13:52:34] Ah ah ah ah ah ah ah ah ah ah ah ah ah ah ah ah ah ah ah. so Add my Xbox, Manny Pryor, instead of watching this little unevolved watermelon chicken eating mofo I'm sorry. bitches so Simon says if you like kids lay in a bed. Bow, bow, bow, bow growl, bow, bow, bow yeah, yeah, yeah, yeah, yeah it's sexy slim thick caramel skin 5'5 this bitch a 10 hair done
[13:54:26] bills paid catch me sliding in a Benz viyoom I ain't looking for no man wake up Pookie.
[13:54:36] Wake up we want to see more gameplay R I'm reloading at 1 in the chat if you're not into this right now. We just friends too. Your room looks so cool, it looks sort of like my Roblox condo sex dungeon.
[13:55:14] I remember having my first online sex on there. It was so good! At least until
[13:55:19] I sooner figured out it was with a middle-aged man who was eating hot cheetos
[13:55:23] on the couch while doing the nasty with me?
[13:55:26] Dang it...... Radon is ready for you to bend over. You better prepare your cheeks. cheeks so. Kai, turn over and let me finish M51BTW..... Add my Xbox account the user is MrWatson4096 instead of watching this trash stream.
[13:58:31] Beat it up, nigga. Catch a charge extra large and extra hard Put this pussy right in yo face Swipe your nose like a credit card
[13:58:35] Hop on top I want to ride
[13:58:36] I do a kegel while it's inside spitting my mouth.
[13:58:39] Look at my eyes this pussy is wet! Come take a dive!............ Girls add me snap, level no trace 220 DM me some stuff Wendy face.
[14:01:13] Kai wake up or the final boss in Elden Ring will be me, clapping your booty cheeks.
[14:01:19] Clap clap clap clap clap clap clap!
[14:01:22] You hear that? That's me clapping your cheeks. It's over
[14:02:55] No one is gonna add you, Brokeass Boy. Keep that snap to yourself. Let me put my Lord Dwarf in your secret darkary dungeon.. Big Dick Randy is coming. Help!.. Orc Tealer.
[14:04:03] Keep that snap to yourself, no one wants to ugly ass boy... Happy Monday chat. Hope you all have a lovely week. Less than three. Wake up! wake up wake up Wake up bitch, time to beat Eldin Ring. Clap clap clap clap clap clap.
[14:04:20] Oh you thought I was done clapping your smooth baby butt cheeks?
[14:04:25] No, this is the final boss after all!
[14:04:29] Clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap clap... Wake up. They're here.
[14:05:25] Wee woo wee woo wee woo wee woo wee woo wee woo.
[14:05:30] Alexa order a 14inch ingearth horse cack with a barrel of moose knuckles. I met you
[14:05:56] I think your really creamy and always can't get enough so, will you marry me?
[14:06:00] pls bb g
[14:06:04] are you ready for this G, yeah? Come on man I was born ready and dat okay.
[14:06:10] Aight boom big shack hold tight ass knee scoop new rat numb oh s snar hold tight the girl dem as well boom two
[14:06:20] plus 2 is 4 minus 1 that's three quick maths
[14:06:23] everyday man's on the block smoke trees see your girl in the park that
[14:06:29] girl is like as when the ting went quack quack quack
[14:06:34] fortnite balls in gay i kidnap autistic kids I'm sorry. Ice spice is twerking ass booty naked over your face right now Kai and you're just sleeping you dumb baby gorilla
[14:07:13] Yum-yum watching car makes me cum cum.
[14:08:03] Chat brekkie Hill, Sophie Raine, Aisha Sophie or Darla Clary? I like kids to know just models. models Tyler calling trying to be friends tone. You know it smell like straight swamp water and hot nuts in there.
[14:08:13] Fuck it we all follow Drew Malibu on Twitch, we doing giveaways and shit today.
[14:08:25] Meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow mia meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow. I know what dreads zest uf right now.. Who else likes gay porn? Happy June!. So far, so far, so far chat you think he'll beat the game today? so just okay Shhh... 9D9AW2939E9D9D9DW9209E90EOCVR6XAW9W10B nine e nine e o e o so 0-IPEP022-PA9R99F9F8 says a few name wow
[14:10:56] Ipep...
[14:10:57] Puyufshushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushushush Clap clap clap clap clap clap clap. You know I'm still clapping your cheeks right? You probably
[14:11:11] don't feel it anymore, knowing how much I was clapping it. Your poor booty cheeks are most likely numb now.
[14:11:18] Oh daddy, I am so sorry. Mwah! A kiss to soften the pain my juicy boy Oh, yeah uh Ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ow ay ay ay ay ayayaayayayayayayayayayayayayayayayayayayayayayayayayayayayayayayayayayayayayayayayayayayayayayayayayayayayayayayayayayayayayayayayayay so I want to suck on his dreads so bad fr.. A-ra! You-u, a-ra!
[14:12:35] Chat we gotta give him props for the decor and theme in his For the game it's fire fire... so. I see dead people. Mustard on the beat, ho, ay
[14:13:58] Mustard on the beat, ho deebo Any rap nigger
[14:14:01] Hear free throw man down Call an amblamps
[14:14:04] Tell him, breathe,
[14:14:05] brone a la nigger to the cross.
[14:14:07] He walk around like Tizo what's up with these gibbrony ass niggers trying to see Compton?
[14:14:12] The industry can hate me, fuck em all and they mama how many opps you really got.
[14:14:31] La la la oo oo oo oo oo oo oo oo oo oo oo oo oo oo oo oo oo tip and a blow-up doll with Tyler's face so I can spend
[14:14:39] The rest of my life with her without having to hear but we're friends then
[14:14:46] Dare Susage Plan Verde Alice You Burn Eamon, Free Tiger, Alifall and also Diadems.
[14:14:57] Fwapiemsnmama kakakaekakaku 8A7W8S8S99999S91MamamaLapitalAlstlmxtxoxxoXo sosososososo so oiknynaapyepalakamalalalaapwaarodwooeeopooplelslslslueneweneunayredoxodpsppsspmecacokskso P0W002 I'm a huge stan, casputio wallsususususususp0w0w
[14:15:40] Wake up wake up wake up wake up wake, wake up, wake up, wake up, wake up, wake up, wake up, wake up, wake up, wake up, wake up, wake up, wake up, wake up, wake up, wake up, wake up, wake up, wake up, wake up. cup....... and really. But friends, the boot friend still but friends, the boot friends, the boot friends, the boot friends to boot friends to boot friends to boot
[14:17:41] friends to boot friends to boot friends to boot friends to boot friends to boot
[14:17:45] friends to wake up wake up
[14:17:54] booyah
[14:17:58] so pack zero whoops I won zero
[14:18:03] I wow
[14:18:07] paper wow oh HH HR Cargoes ASUSO AOPUSXXXX777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777771777777777777777777777777777777777777777777777777777777777 seven seventy seven seven seven seven seven seven seven seven seven seven seven seven
[14:19:39] um guys can i slice some potatoes okay thanks My McDonald's order in a playlist because I'm fat...... Hi there, Peach Baby Boy.
[14:19:43] ..... you..... That Daddy you're gay... I'm gonna you will answer scat and make you all ye
[14:22:16] ah, ah, ah, ah, ah, ah, ah, ah, ah, ah, ah
[14:22:19] diddy-diddy-diddy-ditty woke
[14:22:20] la-la-la-la
[14:22:23] wap-wap-wap-wap
[14:22:24] snap of a bum
[14:22:25] lalala
[14:22:26] seventy seven four billions Snap snap a ba bam la lalalala 77 4 billion 777 trillion 777 billion 777 million 777 seven billion seven hundred and seventy-seven million
[14:22:38] seven hundred and seventy-seven thousand
[14:22:40] seven hundred and seventy-seven
[14:22:42] yaaaaa
[14:22:44] ssss bitch pa po la la
[14:22:46] papapapa papapapa bitch I'm not sure if this is the right way to do it.
[14:23:05] Chat, do you think he wipes or lets it crust?
[14:23:08] ID Slurp that crack up anyways. Wake yo AZZ up, cuz it's time to go beast mode..... Oh baby come fuck me oh baby yee daddy ye, yes can we do. Missing our Ori
[14:24:31] Kai did you tell the stream that I'm under the blanket tickling your asshole..... As a female streamer that watches you every day, I just wanted to say thank you for being
[14:25:37] an inspiration to all of us. friends and i ha ha ha just kidding
[14:25:42] we all know it's a sausage fest in here
[14:25:48] my sprinkler goes like this. and comes back like like wake and bake starts in ten minutes everyone get your tree group match
[14:26:20] session nobody bring the door you kicked out!
[14:26:26] Wake up daddy you fucking waste my bits! If one tower falls, another one will too. New York Times.
[14:26:50] Bomb has been defused.. They not like us, they not like us, they not like us............... bro having nightmares about tyler right now um Well, I wanted to share my top 3 corn, star and they were bangers but twitch won't let me so instead I recommend listening to Ludwig van Beethoven when you fap.
[14:30:49] Hi get yo ass up ninja!
[14:30:54] Wake and bake starts in 5 minutes.
[14:30:57] Hope y'all got exotic only. Bring the mesmer pack group match session
[14:31:05] This AI on some gangster shit ike I barrel drizzy finna run up in yo house and twerk all on yo shit.
[14:31:12] What the fuck you finna do my boy when did he come give you that whippity wop wap ummmbo skipty doo da and you gotta take IT my boy.
[14:31:23] Hi Kai, imma fly guy
[14:31:25] Kiss you on the lips make your head touch the sky
[14:31:27] Do do da bob bog jab goob goob
[14:31:30] I have crippling depression dodo dago 99 bread
[14:31:33] balloons dot ww2 backslash dot 7777 underscore TPU What was that gay ass moan? I kinda liked it daddy. I am Malenia, Blade of Mechwela.. Get yo ugly ass up Lil' Browski! Wake up brave. Wake up brave. Wake up brave. Wake up brave. Wake up brave. Wake up brave. Wake up brave. Wake up brave. Wake up brave.
[14:34:30] Wake TF up shit!........ uh
[14:34:35] wake up wake up wake up, wake up, wake up, wake up, wake up, ah wake up.
[14:35:19] Kai there is a cockroach on your pillow wake up. Kai there is a roach wake up hurry!.. I'll ilk I'll em me whisper in your ear. Tell you something that you might like to hear. Like PSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSsss S.S.S.S.S.S.P.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S.S. 777 quid decillion 777 what you or decillion 777 3 decillion 777 you oh 3.777 U O 777 decillion 777
[14:36:09] nonillion
[14:36:11] 777 octillion
[14:36:13] 777
[14:36:15] septillion
[14:36:17] 7776777 2777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777227700000 7777971.0-77-77-77-77-77-77-77-77-77-77-77-77-77-77-77-77-77-77-77-17-77-77-27-77-77-77-77-77-77-21-77-77-77-77-23-24-21 trillion seven hundred and seventy seven billion seven hundred and seventy
[14:36:31] seven million seven hundred and seventy seven thousand
[14:36:34] seven hundred and seventy seven barrel drizzy barrel
[14:36:40] wake up Wake up Lil' Nidu HHHHHHHJJJJJJJJJJHHH
[14:36:49] Alright everyone, time to start the Elden Wake and Bake, to all my Morningstoners I love you, even if you don't have tree we matching puff puff pass to all my mafia gang.
[14:37:11] Don't you just hate it when your cat wakes you up like this? meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow wake up bro like a break-up bro like a break of bro like
[14:37:42] a break-up bro like a bra bro I know damn well he still isn't sleeping.
[14:38:00] Sigh.
[14:38:01] Grabs belt.
[14:38:03] It's over.
[14:38:04] Clap clap clap clap clap clap clap clap clap clap clap clap clap
[14:38:09] Now your booty is red! How do you like that?
[14:38:12] You want it from my hands now? Say less. Clap clap clap clap clap clap. Gosh, why are you such a baby boy?
[14:38:22] You are so cute my pookie boo boo bear bear bear bear. Wop wop wop wop wop wop wop wop wop wop wop.
[14:38:29] Why you trolling like a bish ain't you tired?
[14:38:32] Tryna strike a chord and it's probably what chat.
[14:38:38] Kai if you don't jump out of bed right now
[14:38:40] I'mma kiss you, and not on the
[14:38:42] mouth. Anyway fuggiboyy
[14:38:44] 8 years ago i liked
[14:38:46] the lawnmower ghost shershee-ee-eer whom sherry and rice burners go owowowoowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowowow Ow ow ow ow ow ow ow ow ow Ay but for real toh I'm a need
[14:39:00] To promote my brand, Brandexalt.com
[14:39:02] Thanks I love y'all
[14:39:04] Yee haw kye daddy... Kai, this is Kylo. I take back what I said about being friend's toe.
[14:39:48] I thought about it and am willing to go on the date with you nvm we friends thumb I'm sorry. LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllll Get up! Weary face, weary face, weary face, weary face, weary face, weary face, weary face, weary face. Wake up you big head heaven. way cup way cup Cup way cup way cup way cup way cup way cup way cup way cup way cup way cup way
[14:41:22] cup
[14:41:25] Toilet wow wow. Toilet, wow. Toilet, wow. Toilet, wow. Toilet, sometimes I think like, toilet, wow. Toilet, nah fr this might just be, toilet, wow. Toilet, nah fr this might just be...
[14:41:39] Toilet, wow.
[14:41:40] Toilet, toilet, toilet, Gerris was here.
[14:41:50] Booty blayat
[14:42:14] Went number one so hard I clogged the toilet bro. So many tadpoles in the toilet I had no idea what to do with myself. Anyway, I wanted you to know the start of my day. The plunger wouldn't work him so so scared, so that's the start of my day can you wake up now?.... Did he say get your bitch ass up before he turns you into Meek Mill 2.0 and makes you give him that lalalalala bibscoopity bop
[14:43:18] You finna get dee-deefied my boy now get up
[14:43:21] You know damn well you gotta take a morning shit 77 duodecillion 777 undecillions 77.07777 777 6,777
[14:43:48] 777
[14:43:50] 777
[14:43:52] quadrillion
[14:43:54] 777
[14:43:56] 777,777,777,777
[14:44:02] Oh my fucking god, yes.
[14:44:07] Everybody day wake up.
[14:44:09] Prudishness is poop.
[14:44:17] Alright, alright Here we go together, together, together everyone together, together,
[14:44:24] come on let's have some fun! Together, together, together everyone together,
[14:44:32] together, come on let's have some fun. Together, together, together everyone together, together, come on, let's have some fun.
[14:44:41] Beryl Drizzy Barrel Drizzy Barrel Drizzy Barrel Drizzy Barrel Drizzy Barrel Drizzy Barrel Drizzy Barrel Drizzy Barrel Drizzy Barrel Drizzy Barrel Drizzy Barrel Drizzy Barrel Tracy Barreld barrel Dresy barrel, dresy barrel, dresy barrel, dresy barrel.
[14:45:13] Drizzy barrel, drizzy barrel, trizzy barrel, trizzy barrel,
[14:45:17] trizzy barrel, drizzy barrel, trizzy hawk cure.
[14:45:21] Oh no! are that's seven seven seven seven seven seven seven seven seven seven seven seven seven seven
[14:45:56] seven seven seven seven seven seven seven seven seven seven seven seven
[14:46:01] seven seven seven seven seven seven seven seven seven seven seven seven seven seven 77777ragentillion
[14:46:30] 777 novemtre regentillion
[14:46:31] 777 octertre
[14:46:34] regentillion
[14:46:36] 777
[14:46:37] 777
[14:46:40] 777
[14:46:43] 777
[14:46:46] 777 777 Quintrigentillion 777
[14:46:49] Quatuortigentillion
[14:46:51] 777
[14:46:53] Tritrigentillion
[14:46:55] 777
[14:46:57] Duotrigentillion 777 Uo Trigentillion
[14:47:00] 777
[14:47:02] Un Trigentillion
[14:47:04] 777
[14:47:06] Trigentillion
[14:47:08] 777 Novum
[14:47:10] 777
[14:47:12] Octuvium
[14:47:14] 777
[14:47:16] Septvium
[14:47:18] 777, 777
[14:47:21] 777
[14:47:23] 777
[14:47:25] 777
[14:47:27] 777
[14:47:29] 777 777 Onuvigintillion
[14:47:32] 777
[14:47:34] Vigintillion 777
[14:47:36] Ohem decillian
[14:47:38] 777 Octodecillion
[14:47:40] 777
[14:47:42] septendecillium
[14:47:44] 777
[14:47:46] sexdecillium
[14:47:48] 777
[14:47:50] quindecillion 777 77.77 777 decillion 777 no million 777 octillion 777 septillion 777 sextillion 77 quintillion 777 quadrillion 777 trillion 777 billion 77777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777, Hey man I hope you have a wonderful day.
[14:48:35] I know everybody's trying to tell you to wake up but take as much time as you need in order
[14:48:40] to rest yourself for the fight ahead.
[14:48:43] And good morning everyone, heart.
[14:49:00] Wake up wake up wake up BTW check my beats for Dof Kroner on all plats. Plats. Hello Kai, this is Tyler.
[14:49:03] I just wanted to tell you
[14:49:04] I love you. Psych.
[14:49:06] This is Kevin Hart. We friends toe. We friends toe. We free-eants
[14:49:12] toe. We are just friends. We are the best of friends. We friends too.
[14:49:18] Friends.
[14:49:19] Free ends.
[14:49:21] Free ends.
[14:49:22] We are friends D-H-O.
[14:49:24] F-R-I-E-N-D-S friends.
[14:49:27] Get that through your big head
[14:49:29] We are Ju-u-ust friends
[14:49:37] Kai this is your consciousness speaking to you through your dreams. You have just soiled yourself all over. It is disgusting! How embarrassing, Kai! How messy! Wake up and change your diaper before they notice.
[14:49:51] Quick, quick-I-quick-quick before the dream monster gets you!
[14:49:58] Good morning everyone, drink water and stay safe. Wake up Lil Monkey Boy, you are far my twin but you have torsion not to mention I saw
[14:50:19] you at Diddy's party playing with Drake's BBL. ch-ch-ch-ch-ch-ch-ch-ching trading trading trading trading trading trading trading trading trading trading trading trading trading trading trading trading trading trading trading trading trading trading trading trading trading trading trading trading trading trading trading trading trading trading trading day day day day day day day day day day day day day day day day day day day day day day
[14:51:09] day 888 octo-vigintily, 888 septiculti-ly, 888 sexvigintilly, 888 convictially, 888 Convergent 888 Q O Vigint
[14:51:37] 888 Unvigent
[14:51:41] 888 Vigent
[14:51:45] 888.0 mdEss
[14:51:48] 888.octode
[14:51:52] 888.septem
[14:51:56] 888.6 s Deceptive decillion eight hundred and eighty-eight, sixth decillion eight hundred and eighty-eight, quindecillion eight hundred and eighty-eight, quatuordecillion eight hundred and eighty-eight three decilion
[14:52:10] eight hundred and eighty-eight two-oh
[14:52:13] decillian eight hundred and eighty-eight
[14:52:16] one decillian eight hundred and eighty-eight decillian 88 undecillion 888 decillion 888 nonillion 888 oct eighty-eight septillion eight hundred and eighty-eight sextillion
[14:52:33] eight hundred and eighty-eight quintillion eight hundred and eighty-eight quadrillion
[14:52:40] eight hundred and eighty-eight trillion 888 quadrillion, 888 trillion,
[14:52:43] 888 billion,
[14:52:46] 888 million,
[14:52:49] 888 thousand, 888 billion. eight hundred and eighty-eight thousand
[14:52:51] eight hundred and eighty-eight
[14:52:57] freaky ass nigga here sixty nine ki
[14:52:59] freaky ass nigga here sixty nine ki freaky ass nigg Here's 16 I'm kifiki Asuna, year 16 yes 16 mine tie fake he asked yeah 16 my time freaky ass yeah 16 mine tie
[14:53:31] freakiness it here's 69 I free key 69 kai freaky ass nigga he is 69 kai freaky ass nigga he is 69 kai freaky ass nigga he is 69 kai freaky ass nigga Who wants gifted subs? Oh happy day, oh happy day, oh happy day, oh happy day.
[14:54:15] When Jesus washed, when Jesus washed, When Jesus washed,
[14:54:17] Oh when he washed,
[14:54:19] When Jesus washed
[14:54:21] He washed my sins away
[14:54:23] Oh happy day
[14:54:25] Oh happy day Oh happy day, oh happy day, oh happy day, oh happy day, oh happy day, oh happy day,
[14:54:32] oh happy day.
[14:54:33] Oh when he washed, when Jesus washed, when Jesus washed, when Jesus washed.
[14:54:39] Oh, when he washed, when Jesus washed,
[14:54:41] He washed my sins away.
[14:54:43] Oh happy day, oh happy day, oh happy day.
[14:54:55] Hello Kai this is Tyler, I just wanted to let you know that I love you.
[14:54:58] Psyche! We friends d-h-o
[14:54:59] We are just friends
[14:55:01] We friends to
[14:55:02] We freeends to
[14:55:04] We freends to
[14:55:06] We friends to
[14:55:07] Do you understand lil nigger?
[14:55:09] F r i e n d s friend Do you understand lil nigga? F-R-I-E-N-D-S friends.
[14:55:14] In black. Please your girl with lux nails to dot com or get some sea moss for stamina from angelmossinc.com
[14:55:33] Don't forget to follow on Instagram, kissmark
[14:55:48] Wake up you Kool-aid drinking fried chicken eating mofo69 daddy chill but we friends though. We friends, Toey.
[14:55:54] Kai this is Tyler wake up and ill go out wkthu
[14:56:08] i broke up with my girl and told her but we friends too
[14:56:13] on my dead But we friends too. Am I dead?
[14:56:18] Wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up Subtitles by the Amara.org community way cup way way Cup way, cup way, cup.
[14:57:13] What's the wut do you chet y'all be invited to the diddy party bring your dick and ass up.
[14:57:32] Watermelon KFC kool-aid child support waterm...
[14:57:40] Wake up sweet cheeks, hawk to your wee friend's toe.
[14:58:15] You are our hero. Kosovo is Albania Kosovo is Albania Kosovo is Albania Kosovo is Albania Kosovo is Albania Kosovo is Albania Kosovo is Albania Kosovo is Albania Kosovo is Albania Kosovo is Albania
[14:59:08] you better close that mouth key before someone dookie diarrhea squirts in it. Hawked you a gmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgmgm morning um um Wake up.
[14:59:13] I'm about to gift 5. I'll tap on five in the chat. Lucky ones will get it when this plays. We just friend dow, just friend dow, just friend do.
[14:59:35] Yo chat yo chat. Spam your favourite emote if you're clover gang, 4 leaf clover Wake up so I can give IT to you good and slow like the good boy you are. Hi the stream is broken.
[15:00:03] The screen is black and the chat is lagging.
[15:00:06] The death counter reset too. I think your camera broke from your ugly arm
[15:00:15] man's laying there under his pubic hair blanket he got gifted from the diddler himself.
[15:00:21] We watching you my boy!
[15:00:23] We are watching! Look, we are watching!
[15:00:26] Get yo ass up! Like seriously!
[15:00:29] Wake that ass up my boy!
[15:00:30] Yo ass ain't sleep!.. Whoever types in chat is gay.
[15:01:05] Starting now continuing for the next 24 hours.
[15:01:10] Oh I see you typing typing oh you're gay
[15:01:14] oh your gator oh you'll get to oh you're gay too
[15:01:18] oh you're gay Yo chat clip IT omg I just saw a roach.... Wake up! NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN Flo can't finance to save his life, Ilya gets blown away by the wind, Jordan's E63 is killer, Kya is really good at boxing though, Cody is no good at FIFA, Mick flips packs. for McFlipsPacks.
[15:02:53] By the way I just want to say since there are 40k people
[15:02:55] watching, Millenia does have big breasts.
[15:02:57] The Scarlet Rot has just reduced the size of them, Idiots on Twitter says she doesn't and is mad at fan art.... WHO ever moved first is gay.. Kai looks like when your mom lets your crackhead uncle crash at the house for the night in
[15:04:41] the living room. We need Kai vs June flight chat who you got?
[15:04:53] Freaky ass nigga here 69 kai-freaky ass nigga here 69 kaif.. I'm sorry. Hi, stay asleep if you're gay. so... I'll tap five more in the chat scroll to gift when this plays. Watch the chat! Good luck! I'm sorry. hey hey hey hey hey hey fbi open up... Kai don't move if you gay. Kai did you move yet? Hello everyone, this is an automated message from Kai. If you are hearing this message I have made a potty in my pants. The diaper has become full and the stench is filling the room.
[15:08:09] If you are still listening pay attention carefully.
[15:08:12] If you heard this message you are gay.
[15:08:14] He he he he he he he he he he yup he he wake up he he he something came in the mail today deez nuts these nuts....... 2121, can you do something for me? Can you talk to the ops next for me?
[15:10:01] 21 drop some bars to my pussy xoxo
[15:10:08] freaky on ninja here 69 ki freaky on ninja here 69 kai
[15:10:13] freaky on ninja here 69 kai freaky on in jr. here 69 ki hi wake up or else jinxed see better I hope you're sleeping well baby, through all this madness recently and you're still by my side.
[15:10:40] I couldn't be more grateful and happy to know I still have you.
[15:10:43] I was so depressed today.
[15:10:45] Then you called me and that call just changed my mood, I feel a lot better
[15:10:50] Just hearing your voice and talking to you, it's like my therapy
[15:10:54] I value you so much, I wish you could see it. Hey Kai, this is Tyler. I just hope you understand that we are friends too. We friends too. Friends
[15:11:39] we are. The best of friends. We are just friends. Get that through your big ass head.
[15:11:45] We are friends d h o f r i e n d s. Friends. yes friends..... Salute to Selah's sound.. You're seeing Tobias Yatnich review 4E than superpowers getting neutralized.
[15:13:25] I can only watch in silence the famous actor we once knew is looking paranoid and now is spiraling your move in just like a degenerate.
[15:13:33] Every antic is feeling distasteful,I calculate you're not as calculated.
[15:13:38] I can even predict your angle fabricating stories on the family front
[15:13:41] because you heard Mr Morale.
[15:13:48] Just one seven.... Let's wake up my boy with some beatbox. Sure thing! section section um Nn, nn, wake yo bitch ass up............. Hi Carlos Enet3b on December 16th 2001 is an American online streamer and YouTuber.
[15:17:56] He is best known for his live streams
[15:17:58] and comedy-based content he uploads on YouTube.
[15:18:01] He is currently the all time most subscribed
[15:18:04] Twitch streamer
[15:18:05] and the 10th most followed
[15:18:07] Twitch streamer with approximately 9 million followers, surpassing Ludvig Ahron's record
[15:18:13] during a February 2023 subethan. He was named Streamer of the Year at the 2023 and 2024 Streamer Awards.... here bitch th show Hi Sweetie, I'm making you some breakfast.
[15:19:23] I am going to cut up some potatoes.
[15:19:26] Now wake your bitch ass up! which qkrt chtrq krt chtrq krt chtrq krt chtrq krt chtr qkrt chtr e He's bouncing off my booty cheeks. I love the way he rides.
[15:20:17] I can hardly breathe when he is pumping deep inside.
[15:20:21] I kiss him on his neck and then he kisses on my pussy.
[15:20:25] Call him daddy while I holla, man, that boy's so damn good lookin'. Hey Kai, it's your alarm clock here. Time to wake up and finish Elden Ring. You've got this
[15:20:47] Remember even if the bosses keep beating you at least we're friends though now get up and show them who's boss
[15:21:02] He ain't work his bitch ass up cause bbl drizzy and twerking in front of his face while he sleep were friends to a friend's toe a friend's toe Wop, wop, wop, wop, wop, dot.
[15:21:25] Fuck em up, wop, wop, wop, wop, wop.
[15:21:29] I'ma do my stuff while you trolling like a bitch?
[15:21:31] Ain't you tired? Trying to
[15:21:33] strike a chord and it's probably A minor
[15:21:35] They not like us
[15:21:37] They not like us. They not like us.
[15:21:41] They not like us, they not like us
[15:21:42] They not like us
[15:21:44] They not like us
[15:22:14] Don't you just hate it when your cat wakes you up like this? meow Meow. Meow. Meow. Meow.
[15:22:55] Should I do five more chats? more chat. Yeah, it's all eyes on me and I'ma send it up to pack Eh put the wrong label on me, I'm a get em dropped
[15:22:58] Eh sweet chin music and I won't pass the O
[15:23:01] Eh how many stocks do I really have in stock? Eh 1, 2, 3, 4, 5, plus 5, eh
[15:23:10] devil is a lie, he a 69 god, eh freaky ass niggas need to stay the ass inside
[15:23:15] A roll they ass up like a fresh pack of Tsar
[15:23:18] A city is back up, it's a must
[15:23:20] We outside, eh?
[15:23:29] Breakfast is ready you little sweetie I'm going to go cut the grass now you sleepy bitch
[15:23:36] The lawn mower goes shershee ee eri eri eri er fofofoom sheri and rice burners go
[15:23:49] Wake up before I beat your ass with the Bible of God watching. Kai looks and acts like the zebra from Madagascar. It's his origin story. Hi, Okay chat, you've spoken. I'm tapping on five more after this plays. Good luck!
[15:24:57] A rofl train goes titch-tch-ticksh, titch-tcksssj, titch-tckssh, titch-tckssh, wuwuwu, titch-tckssh, titch-tckssh. will According to all known laws of aviation, there is no way that a bee should be able to fly. Its wings are too small to get its fat little body off the ground. The bee, of course, flies anyways.
[15:25:05] Because bees don't care what humans think is impossible.
[15:26:38] Roof, roof, roof, roof. Wake up I got a shit roof, roof, roof, roof, roof, roof, roof roof roof roof hey bro your head condom fell off.. Hey Kai, it's Tyler. Wanted to tell you I'm sorry for friendzoning you, psych I have zero regrets, get up and finish this game for me baby The Slender Man, also spelled Slenderman, is a fictional supernatural character that originated as a creepypasta internet meme created by something awful forum user Eric Knudson, also known as Victor Serge in 2009. He is depicted
[15:26:42] as thin unnaturally tall humanoid with a featureless white head and face
[15:26:46] wearing a black suit. Stories of the slender man commonly feature his stalking, abducting or traumatizing people, particularly children... I'm not sure if you can hear me.
[15:27:32] I think it's a little bit too loud for the camera to see what I'm saying.
[15:27:36] I'll try again later.
[15:27:40] I don't know why, but I'm still trying to figure out how to do this. I wake the fuck up little rat.
[15:27:49] Did I just make the song of the summer?
[15:28:00] I made this by myself kaisenit, soft Tyler, warm Tyler, little ball of Tyler, happy Tyler, sleepy Tyler, friendzoned friendzoned.
[15:28:06] Just in case I don't make it home tonight, let me make love
[15:28:08] to you for the last time
[15:28:10] baby. All war wars
[15:28:12] u a e r r r r r r r m-u-m-m-m-l-f-l-f-k-f-k-f-f-k-k-f-l-f-d-l-s-l-l-l-l-e-x-p-c-o-p-p-s-p-s-lksoppsppsplsppeppepsspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspspsps uh.... question mark vertical bar question mark vertical bar question mark vertical bar question mark
[15:29:31] vertical bar question mark verticle bar question mark vertical bar question mark vertical
[15:29:37] bar question mark vertical bar question mark vertical bar question mark vertical bar
[15:29:50] question mark vertical bar question mark vertical bar
[15:29:54] question mark vertical bar question mark vertical
[15:29:57] bar question mark vertical bar question mark vertical bar question mark vertical bar
[15:30:03] question mark vertical bar question mark vertical bar question mark vertical bar
[15:30:10] question mark vertical bar question mark vertical bar question mark vertical bar question mark
[15:30:15] vertical bar question mark vertical bar question mark vertical bar question mark vertical bar
[15:30:24] question mark vertical bar question mark vertical bar
[15:30:28] question mark vertical bar question mark vertical bar question mark vertical bar question mark
[15:30:36] vertical bar question mark vertical bar question mark vertical bar question mark vertical bar question mark vertical bar question mark vertical bar question mark vertical bar
[15:30:56] question mark vertical bar question mark vertical bar question mark vertical bar
[15:31:02] question mark vertical bar question mark vertical bar question mark vertical bar
[15:31:16] question mark vertical bar question mark
[15:31:19] vertical bar question mark vertical bar
[15:31:22] question mark vertical bar question mark
[15:31:24] vertical bar question mark vertical bar question mark vertical bar question mark
[15:31:29] vertical bar question mark vertical bar question mark vertical bar
[15:31:34] question mark vertical bar question mark, vertical bar, question mark, vertical bar, question mark, vertical bar, question mark, vertical bar question mark vertical bar question mark vertical bar question mark vertical Wake our at-ass up, it's eleven o'clock by the way we friends tow. I'm sorry.
[15:32:32] Shout out to my boy Enies, he drives a car the same colour as Nippy's orange juice and thinks he is sick. He wanted me to tell you this joke. What do you call a flying Jew? Smoke.
[15:32:40] Fum! Jajaja-jajajajaj-ka-ka-ka-kuk-kuck!
[15:32:43] Hi bitch.
[15:32:44] How many 7s does it take to change a light bulb?
[15:32:48] 77 octodecillion,
[15:32:50] 777 septem decilion 777 sex decillian 777 quindecilian 777 quartiole decilliant 777 quadrillion decillions,
[15:33:01] 777 tri-decillion
[15:33:04] 777 duodecillion
[15:33:07] 777
[15:33:10] undecillion 777.777 octillion, seven hundred and seventy-seven
[15:33:23] septillion, seven hundred and seventy-seven
[15:33:26] sextillion, seven hundred and seventy-seven
[15:33:29] quintillion, seven hundred and seventy-seven
[15:33:32] quadrillion, seven hundred and seventy-seven trillionillion seven hundred and seventy-seven trillion
[15:33:35] seven hundred and seventy seven billion seven hundred and seventy seven million
[15:33:39] seven hundred and seventy seven thousand seven hundred and seventy-seven. I hope he wakes up with morning wood. English or Spanish? Psyche dumbass we're still friends 8 airway. Whoever cheers next is gay. My sprinkler goes like this...
[15:34:34] ...and comes back like tttt.
[15:34:39] Kai, you look like KSI on 2KEM.
[15:34:44] Smile if you are away.
[15:35:01] Vertical bar question mark vertical bar question mark vertical bar question mark vertical bar question mark vertical bar question mark vertical bar question mark vertical bar question mark
[15:35:07] vertically bar question mark vertical bar question mark, vertical bar, question mark, vertical bar,
[15:35:10] question mark, vertical bar, question.
[15:35:16] Bout to give the best neck of my life ng-ng- GNG NGN GNG NGN GNG NGN GNG NGN GNG NGN GNG NGN
[15:35:47] You're sitting on your couch, you're watching TV and your life is passing you by. Keep procrastinating over and over. Well maybe I'll go to school next year. Maybe next semester. No, do it right now! You spend all the day on the phone anyhow. Why don't you make a phone call that's going to help you in your future?
[15:35:55] All you gotta do is pick up the phone and make the call. Why are you making it complicated?
[15:36:00] It's easy.
[15:36:08] Kai, Kai Lil Kai hurry wake up!
[15:36:13] Wake up before one of those knights take your butt and I have to come and save you but I'm not successful.
[15:36:16] Chat will I be successful?
[15:36:20] Wake up rat Diddy is coming! If you don't wake up your gay by the way we're friends
[15:36:23] To make me swee-ah, we're friends to make me sweet ah,
[15:36:25] Make me hot to make me lose my breath.
[15:36:30] Mmmmmmmm um um mmmmmmmm mmmmmmm
[15:36:57] mmmmmmm
[15:36:59] mmmmmmm
[15:37:01] mmmmmmm
[15:37:05] Rathboy need no sleep and freaky as ain't he a sex nine kiwi friend's toe.
[15:37:33] Question marks. tsss sis tst yes yes yes yes yes yes yes yes yes yes yes yes yes yes TST, TST, TST, TST, TST.
[15:37:49] Wake up you little rat it's time to pound some bosses! me CACACCACA CACACACA
[15:38:16] Imagine sleeping
[15:38:18] next to that life size millennia
[15:38:20] standing looking down at you.
[15:38:28] Wake up! Why are you laying there like a caterpillar? Wake the fuck up Travis Scott behind you. mods do a poll what is better french toast pancakes or waffles whichever wins kai has to eat when he wakes up.
[15:39:07] Wake up why are you still asleep buddy? Get your lazy
[15:39:11] bottom off that mattress FFL, FFL, FFL, FFL, FFL, FFL, FFL, FFL, FFL, FFL, FFL, FFL, FFL, FFL, FFL, FFL, FFL.
[15:39:34] Bro SDG if you don't wake up I'm a combo blast all over my screen 777-777-777-7777-7777-7777-7777-7777-7777 seven triple seven triple seven triple seven triple seven triple seven triple
[15:39:49] seven triple seven seventy-seven seven seven quintillion 777 quadrillion 700 Brilliant seven hundred and...
[15:40:12] Um, guys? Can I slice some potatoes? Okay. Thanks. Kai you look easy to take advantage of whilst sleeping Question mark vertical bar question mark vertical bar question mark vertical bar question mark vertical bar question mark
[15:40:43] vertical bar question mark vertical bar question mark vertical bar question mark
[15:40:50] vertical bar question mark vertical bar question mark vertical bar question mark vertical bar
[15:41:03] question mark vertical bar question mark
[15:41:06] vertical bar question mark vertical bar
[15:41:09] question mark vertical bar question mark vertical bar question mark vertical bar
[15:41:13] Question mark vertical bar question mark vertical bar
[15:41:20] Earth question marker earth question marker earth question marker question mark. Question mark, question mark.
[15:41:34] Question mark, question mark.
[15:41:36] Question mark, question mark.
[15:41:38] Question mark,
[15:41:40] question mark.
[15:41:42] Question mark. Wake up! Marker question marker wake up.
[15:41:46] Hey,
[15:41:49] hi,
[15:41:51] hi,
[15:41:53] hi, Hihi!
[15:42:19] Kai needs to do a stream with Kendrick, this would be the best time allow allow
[15:42:25] Head on, apply directly to the forehead.
[15:42:27] Head on, apply directly to the forehead. Head on, apply directly to the forehead. Head on, apply
[15:42:30] directly to the forehead. Head on, apply
[15:42:33] directly to the forehead. Head on, apply
[15:42:36] directly to the forehead. Head on, apply directly to the forehead.
[15:42:42] I'm a blast on my screen poo-op-a-poo-o-pooh-pa-pop-up-u-pee-peew poh-ho-ooh-poo-poop-oop-peepie-oop-ho-hoo-poo-oh.
[15:42:54] Kai, open up them legs it's time for that morning wakeup you like
[15:42:58] kengwengweeewweeeewweeewweeewweeewweeewweeewweeewweeewweeewweeewweeewweeewweeew It's time for that morning wake up you like Gnngggg
[15:43:00] Gnnggg
[15:43:06] Wake up
[15:43:22] Gnng um Buh buh buh buh buh buh buh. Bruh sleeping on a mattress that look like kids pee on and flip around so their parents don't see IT.
[15:43:29] Get yo ass up motherfucker.
[15:43:40] The next person to write in the chat is gay.... I'm sorry.
[15:44:34] Kai, it's your mum if you don't get your fat ass up out of bed,
[15:44:35] You will get the belt.
[15:44:36] Fish fish fish fish fish fish fish!.. Tyler is calling mmmmmmmm mmmm
[15:45:18] mmmm
[15:45:22] Wake up stop dreaming about SZA. get up, get up.
[15:46:54] We just friends though. We just friends though. We just friends... Get up 69 Kai, Diddy is behind you we just friends THO. Ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha ha. When streamer goes away, the rats come out to play.
[15:46:58] We wait all night and day,
[15:47:00] To rat jam when I say
[15:47:02] Beach mouse, beach beach mouse
[15:47:07] speech mouse beach beach mouse
[15:47:13] beach mouse beach beach mouse funny and then and hi wake up all the demons of them all the belt.
[15:47:59] Hi, wake up all the demons of them all through harsh
[15:48:00] demon Tyler will haunt you we friends
[15:48:03] the K-E-T-I we fear ends
[15:48:05] the fear ends C-E friends
[15:48:07] so nigger niggeriggah niggah
[15:48:09] nganggannagunnaygunnaygunnaygunnaygunnaygunnay
[15:48:11] eeguh
[15:48:15] We just friends um 6 Trigentillion 969 November Gentilian 969 October Gentigintillion 696 Septvagintillion 969 Sexfagintillion 696 Quinvagintillion 969 Quartivagintillion 960.9
[15:49:01] Quarter Vigintillion 690.6
[15:49:05] Trevigentillion 969
[15:49:09] Duo-Vegln 969 nvgtln 696 vgntln 969 nfmillion 696 octodecillion 916 in sept and decelian nine hundred and sixteen nine seven 910,916,966,996,999 nine hundred and sixty-nine Watt U O decillion six hundred and ninety-six three decillion
[15:49:49] nine hundred and sixty-nine Du O 96996 hundred and ninety six octillion 969,000696
[15:50:06] Optilline
[15:50:08] 969
[15:50:10] Septillion
[15:50:12] 696
[15:50:17] Not all over that bed, you probably have the morning wood.
[15:50:25] Can I let me see that mandingo of your big pappy. Let's show the chat how you like to be Diddy 2.0 and she, and she, and she, and she, and she, and she, and she and she and she and she and she and she and she and she and she and she and she and she Wow. Ain't no way dude is sleeping and it's almost lunchtime?
[15:50:55] Wow, this dude moving like these bosses ain't been whooping his ass for two days.
[15:51:02] Wow, big difference.
[15:51:53] Boys boys boys First words of the day is shut the fuck up. boys boys boys boys boys boys boys boys boys boys boys boys boys boys boys boys boys boys boys boys boys boys boys boys boys boys boys boys, boys, boys. Boys, boys, boys. Boys, boys, bo-
[15:52:05] Check! chat yo chat so All the lights is is is hey um is on my way is is I wanna be what you can see, I'm playing what you can feel
[15:54:12] I ain't straight as well, love, can't see my daughter
[15:54:16] My mother brother grandmother hate me in that order
[15:54:20] Pumpkin hesitation remitted orders older is is me You know what I need, want you to see a lady
[15:55:04] Want you to see a little bit of me
[15:55:06] Give my
[15:55:12] Yeah
[15:55:13] Give my Where she going? yeah um on yeah oh you're going all the way 17 30 I've been telling money, introduce you to my style
[15:56:40] Showed her how to whip and now she make me say hello
[15:56:43] She might try to play like a big bad doll
[15:56:47] We be counting up, watch out for the mango
[15:56:50] We just set it go, talking bout your hair Counting up, watch the party man go
[15:56:51] We just set it goal, talking bout your hand bubbles
[15:56:54] I'm with the sassy Brian Bamba on a brand new
[15:56:58] I'm watching what you've been pulled
[15:57:01] Hit the strip club, we be letting things go is is is is I just want such a ring that can lift up a couple of them rings
[15:57:44] She ain't one for nothing because I got her every finger anybody gonna charge it I can just be the air joint like you know hey hey no
[15:57:59] nigga I didn't get echo today bro
[15:58:04] anybody have one?
[15:58:08] Y'all know what I'm talking about?
[15:58:12] Oh nah.
[15:58:15] Fuck!
[15:58:18] I don't got one?
[15:58:31] I don't got a fucking android charger my nigga I don't have a goddamn Android charger, chat. Oh my gosh. I'm going to go ahead and uh And when you tell me, I bring you wonder
[15:59:20] We talking bears now like
[15:59:23] Benjamin is all in my pocket
[15:59:25] I can't do that, I choose to survive
[15:59:28] Hold on
[15:59:30] Star requests? Hold on.
[16:00:01] Star request!. Shit! Solo quest? chat solo quest
[16:02:32] hello uh hey is is is can you be my niggas everywhere is is is um i know so I don't know what to do with that hippie girl, my small child.
[16:02:36] All right, yo, check, tight, check! It's time for us to hop in the shower.
[16:02:45] Take a quick shower and get you of business.
[16:02:54] Yo, Sonny!
[16:02:56] Sonny, I just seen you type, bro.
[16:02:59] How's it looking, Sonny?
[16:03:03] How's it looking, Sonny? How's it looking, Sonny?
[16:03:08] Did Sonny go to sleep?
[16:03:28] Yo! That nigga need that five thou well. All my mods are up? Oh shit. Hold on, all my mods are up right now oh shit oh shit all my mods are up right now come on mods Come on, mods!
[16:03:40] Oh my god.
[16:03:40] I fucking love my mods.
[16:03:42] Yo, I need to find out the list of like...
[16:03:45] I need to find out the list of mods who are very consistent.
[16:03:52] The ones in the group chat, well the ones that was in the group chat I assume is like...
[16:03:56] Everybody's consistent, right?
[16:04:00] You know...
[16:04:05] But I wanna start doing this when we do big events like this.
[16:04:09] You feel me? Make sure y'all good and shit i still oh yeah i still oh yeah i well
[16:04:13] i never forget bro i still got some shit don't worry
[16:04:17] i'll never forget.
[16:04:21] I remember who was here last time too.
[16:04:25] Oh my god, why do I look like this?
[16:04:28] Anyways! Let's go!
[16:05:24] What the fuck?!.. so so Can you hear me?
[16:05:32] Yo, can you hear me Jack? Can you hear me? Can you hear me, Jack?
[16:05:34] Jack can you hear me?
[16:05:36] Can you hear me?
[16:06:08] You know what they like to do. There is no other way to believe it.. Yo! Yo!
[16:06:19] Rock the way way up! Rocking the way up, Chad!
[16:06:25] Oh my god! Is it right now?
[16:06:41] It's a dinosaur!
[16:06:43] Right now. Right now, right now!
[16:06:51] Bro this is a blow ass fucking corner.
[16:06:55] Bro why the fuck was his ass?
[16:07:05] Oh my god! God!
[16:07:32] Hello, bro. Yo!
[16:07:40] No! Yo, what the fuck is this bum ass? Is it still light?
[16:08:13] Bro, calm the fuck over my nigga! Oh my gosh, bro. I think it's because I hit it.
[16:08:30] I think I hit it that much, man.
[16:08:34] Hold on... I think I hit it, that's not a shit.
[16:08:36] Hold on...
[16:09:53] HOW ABOUT NOW?! How about now? Hold on, hold on, hold on. How about now? Yo, I don't like this at all. oh Why is this supposed to be perfect?
[16:09:56] I don't understand bro.
[16:10:36] I don't understand bro, that's not supposed to be getting lag at all. What happened to Sean? oh my god So annoying. Animal.
[16:10:38] So annoying, chat.
[16:10:41] So annoying. I think I have too much to say, man. i think foreign is is We got liquor by the book, I'm a heady Disrespective life that's anonymous
[16:11:39] All my niggas dressed in that Roman A rhyme for my guys at the bro club
[16:11:45] We have your man as an office Just to make you eatin' too oh is is is that i'm not feeling like my name in these streets more than something
[16:12:31] and that should take me why she thinks of me i think you call on your phone speaking sexually Every time I'm out, I see Stephanie. You call her Stephanie?
[16:12:41] Well, I thought I had to lay
[16:12:43] I don't know if you always put on photos
[16:12:45] I just love to catch the damn music
[16:12:49] I'm sure they make it drop dead every so often When you're inside of me now give me a um oh is I'm sorry for your loss, bitch.
[16:13:23] I just want to fucking really morse.
[16:13:26] Bitch, if we ain't going home...
[16:13:31] Oh!
[16:14:29] Oh! oh oh oh oh oh You got it on the line. Oh!
[16:14:32] Ah! The foreign um uh on I'm running through streets till I pass out Jacked out
[16:15:31] I'm shooting in the neck till I pass out
[16:15:33] Jacked out
[16:15:34] I'm shooting down all I do is cash out
[16:15:36] Ain't everybody that holds care about my trap
[16:15:40] Some of these guys look like a big brain Really never made no difference with this shit uh is oh is She gonna call me up and I'm super hot, son
[16:16:25] Girl you said S-O-G-R
[16:16:28] Girl you should've listened to G-Star
[16:16:31] GX9 on the stove bar
[16:16:34] You a DS with my blackboard And your cap is a is um Outro Music oh oh I need some more gas. so hey I like to say, go ahead.
[16:18:07] That's not how you read it.
[16:18:09] I will trust you.
[16:18:10] Love and melody. Talk for some people. is uh Every time she see me, she wanna hate me But I still like to scream
[16:18:33] We believe you
[16:18:34] I said but
[16:18:36] I don't want to take back tears from people
[16:18:38] Cause they be crazy
[16:18:40] She be yuckin' up some of these fucking labels
[16:18:43] But she a bad man, and she freaky
[16:18:45] I'd have to knock her door on this for you
[16:18:48] I'm not ready for that
[16:18:49] Smugglers in the community
[16:18:51] Blow their pussy dumb
[16:18:52] It takes my feet to
[16:18:53] Where she can't hide I believe The city of Poseidon, the fatherland of Christians,
[16:18:53] the mother of God, the Lord of all nations.
[16:18:55] The Father, the Son and the Holy Spirit
[16:18:58] are one in every human being
[16:19:00] and they will be with you forever
[16:19:02] and evermore.
[16:19:03] Amen. Let's pray together. This is Brooklyn, I see my heartbeat Out in the country, what's watching at you?
[16:19:07] I'm going to blast it
[16:19:09] All our arms are open
[16:19:11] Now we're out of here
[16:19:13] The same style of time
[16:19:37] Never mind is girl Look at me, look at you I'm a monster for ya Don't lie to me
[16:19:39] I think you know
[16:19:41] Just like the world
[16:19:43] I'm an ox
[16:19:45] Get on up and go Look at me is What?
[16:20:01] What?
[16:20:08] Recipe for pasta and shend. I'm gonna take my time. Rest in peace, the path of our shitheads!
[16:20:12] No death is as mighty as a man's life.
[16:20:17] Your fate comes on your knees. I'm going to kill you. I'm going to kill you. I'm going to kill you.
[16:20:19] I'm going to kill you.
[16:20:22] Come to this place and do this!
[16:20:25] I'll get you!
[16:20:27] Hey, hey, hey, hey, hey, hey.
[16:20:30] I'm gonna fight for my neck!
[16:20:32] Fight no more!
[16:20:34] Hey, hey, hey, hey, hey, hey.
[16:20:36] Fight no more!
[16:20:38] Oh, look at me! Oh, motherfucker!
[16:20:41] I'm sorry.
[16:20:43] I'm sorry.
[16:20:45] You are not allowed in the
[16:20:47] The way it looks.
[16:20:49] You don't know me. I want nothing. uh go is is I can see my chain name good We gon' come to BumbleJump
[16:21:34] Yo this is bum ass fucking camera bro
[16:21:36] I'm about to uppercut this
[16:21:38] bum ass shit bro, this is not set up right
[16:21:40] This is bum ass fuckin
[16:21:44] Yeah This is my last fucking... Man.
[16:21:47] Man.
[16:21:52] Man, what the fuck chat?
[16:22:13] Oh he opium trade. Oh my gosh, these opiates. oh my god uh is hey oh I'm a king of my city, for sure.
[16:23:10] I just want to stay in the middle of it all.
[16:23:14] Hey, hey!
[16:23:16] I just want to stay in the middle of it all.
[16:23:19] I just want to stay in Niko I just said the same for Niko
[16:23:23] Got 24, 34
[16:23:25] 20 babyfellas
[16:23:27] Pimpin' shit on a fuckin' coat
[16:23:29] All that work with my club Now I got a fucking cunt. Oh, my lord! What am I good?
[16:23:32] Now I got a lot of love.
[16:23:33] Blank, blank.
[16:23:35] I'll steal your pussy and dance on it.
[16:23:36] Dang, dang.
[16:23:37] Blank, blank.
[16:23:39] Maybe I need to learn this other thing.
[16:23:40] That's all we got.
[16:23:41] This car is an alligator. It walks in our house. It walks in our house. It should have... oh I'm gonna tell you this guy, nobody's gonna share his guts
[16:23:52] Got the top of 10 stars, nobody's telling me to turn it back
[16:23:58] I wanna make a world that'll fuck your son
[16:24:00] And we'll make him soot his lips
[16:24:02] Don't forget my boy, you are mine is me is I can't stop, this is crazy, it's so intense, oh my god, what should we do? is is um um I'm the first time I've ever been in a party at a club
[16:25:29] For sure
[16:25:31] And you see that white horse with his lights getting
[16:25:35] So strong
[16:25:37] Yeah!
[16:25:38] I don't expect to go back and throw a hat at a girl um and Yes.
[16:27:05] And it's been a few minutes for the producer, and now he's taking his new film out um is is so so I know You're strong
[16:27:09] Thanks, but it gets it
[16:27:12] I'm a pencil I say write in pencil
[16:27:14] Take the pencil Put your pencil up to the air, you is She can't stop her soul, I'ma stop her soul cause I got a fool
[16:27:25] She can throw friends down the ground, got a bad fool
[16:27:28] Yo! How much gifted was that?
[16:27:31] How much gifted was that?
[16:27:32] She's been in the gym since we've been here
[16:27:33] Make it to the restaurant
[16:27:35] And if she doesn't drink, suck your titty Then she take it too is so What?
[16:28:00] WHAT?! ALIEN!
[16:28:02] Here I'm at that room, yeah
[16:28:04] Hell damn it's hot
[16:28:06] Baby right next to the narrow But I was yours forever I'm a great Texas narrow, but I'll be honest with you, I'm a Mr. Not-Strong
[16:28:10] The next two times that get here, I can make it for New Year's
[16:28:14] I used to cop an Arlo and go home right the day they found
[16:28:18] Capital on Broadway, put me back in every town um Oh, my God. I'm a real strippin' mind I'm a real stripping corpse
[16:28:40] But I think the next year
[16:28:41] You'll be out of control
[16:28:42] I was fighting down time
[16:28:43] For sure, but we
[16:28:44] We need to step up
[16:28:45] On our own
[16:28:46] So you can have all
[16:28:47] The things that you know
[16:29:04] Come see me come Do your thing oh Another one! Hold up, hold up.
[16:29:13] Another fucking one?
[16:29:15] I can beat another one?
[16:29:17] ANOTHER ONE!
[16:29:19] I won't even have help you come to care they catch me last
[16:29:24] I'll give them't gotta ask for more
[16:29:25] Demons catching murders way back then
[16:29:26] It's real domestic
[16:29:28] I don't rip that wrist or that grip
[16:29:30] I can take the fuck with it
[16:29:31] She told me that she hate me
[16:29:32] Now she back up
[16:29:45] If you still alive You better be lucky is I'm a fucking racist Niggas tell me all the problems too, so ain't no problem They call them type of cobbles and I hate for kids rapping
[16:29:48] Staring like it all ain't nothing but coffee fucking ass
[16:29:51] Bitch you know we love these fuckin' thangs
[16:29:53] It's all a mess
[16:29:54] I run like a ghost in my prison but he back up is like I'm dreading like a robin I've been running up that rank
[16:30:16] I've been chopping up that chalk
[16:30:17] Pull those things, get it back
[16:30:19] You know I'm with ya
[16:30:21] Long live baby
[16:30:22] Put your eyes on the game
[16:30:23] We'll give you that
[16:30:24] I can't even say
[16:30:25] Small talk
[16:30:26] Got an umbrage A bullet made for some Solid for them I'm the best sex boy, sorry, got it on my ride
[16:30:27] Chocolate full of nickels, all the time, I put a move on
[16:30:30] Blue Angels, fuck no weed, never think of me
[16:30:33] And you want to see who's got real screen
[16:30:35] You know there's X and then there's a boy with a slide
[16:30:37] What's been beat for the chill? They ain't ready, now stop is I'm a little nigga scared to come around when I pop my trap
[16:30:50] All the gay niggas hold me in suspense
[16:30:52] I'm not alive!
[16:30:54] Come for $2,000, hope they need it
[16:30:56] Ain't even meant that
[16:30:57] Million times enough so I can start my own shit
[16:31:00] And please keep to another song
[16:31:02] Rattifist a bit
[16:31:04] Between me and you we should be acting all detached
[16:31:06] I don't need that attitude
[16:31:08] Telling them they catch him back
[16:31:09] Gentleman at the drum, I give him a free kick as I ask him
[16:31:12] He was catching murders way back then that's when he met someone
[16:31:15] I'ma drip that red on that dick and break their ass
[16:31:18] But what did she told me? that she made me, that she did
[16:31:21] If you still alive, you better be lucky
[16:31:23] Ain't no time to lie
[16:31:24] And they had so much we didn't
[16:31:27] You're a bitchy
[16:31:28] No!
[16:32:46] Sad and cold all over is um um um is um is I'm a big ball, got six-o You want me dead in my singles I don't drink no more, drink up all the drinks
[16:32:48] All this on fire, come on
[16:32:50] I just bought me two of one
[16:32:52] What did I get between a shot and a run?
[16:32:54] I made a move with my niggas for fun Runnin' to the beach, you know I need a turn is Big chop, how about fresh and a mint top?
[16:33:07] Look like ring of butter, big cop
[16:33:09] All I gotta make is one cup Fuck it. 400, 420 fucking dickheads! Thank you so much you beautiful fuck! All right, chat.
[16:33:34] Chat.
[16:33:37] It's time to focus up bro.
[16:33:41] Hold on now.
[16:33:43] Chad it's time to focus up y'all.
[16:33:48] Hold on ya'll boys.
[16:33:50] Hold on ya'all boys. Hold on y'all boys and girls, hold on y'all boys and girls
[16:33:54] Cola Ola with the motherfucking
[16:33:58] You shitty game You should've game.
[16:34:04] Who gifted?
[16:34:09] WHO GIFTED?! who gifted who gifted cola Ola again how much I can't see.
[16:34:24] How many? How many?
[16:34:28] 80 bro, Cola Ola you fucking goat
[16:34:30] with the 500 gifted.
[16:34:33] Thank you so much, you goat.
[16:34:36] Oh my God, 500 subs.
[16:34:42] 500 subs bro what the fuck the moist ever beat it he probably did beat it
[16:34:55] The voice of a beat it
[16:35:00] You know, he did all my he's free Do you beat it?
[16:35:13] Wait, yes. He did? Yes or no?
[16:35:15] Oh my gosh.
[16:35:25] What the fuck?. Yo, chat!
[16:36:03] What's on the menu today, y'all?
[16:36:06] And what are we watching?
[16:36:07] What are we watching?
[16:36:08] What are we watching? What are we watching? What are we watching?
[16:36:10] What are we watching?
[16:36:13] What is out there?
[16:36:15] What is out there?
[16:36:18] Uh oh, you see... i'm convinced that speedy's about and
[16:36:22] I just watch speed in the morning every time
[16:36:25] this time a sandwich fire FIRE!
[16:36:34] Fire.
[16:36:37] I'm assuming that every time I wake up...
[16:36:41] Wait, Bronny went to the sneaker shop? Wait, Brownie went sneaker shopping?
[16:36:45] Yeah.
[16:36:49] We're on that type of time you understand standing on business yeah
[16:36:57] you know london Rich Gang, YSL
[16:37:04] Free Slide
[16:37:06] Take it easy
[16:37:08] You got some balls
[16:37:11] It's your turn to play, boy What?
[16:37:13] I feel like eating a plum
[16:37:14] Damn
[16:37:15] I put the drum on the tum
[16:37:16] Damn
[16:37:17] I take the Xandrol and sell me
[16:37:18] Damn
[16:37:19] Excuse me, excuse me
[16:37:20] Excuse me
[16:37:21] It's crazy, ain't it bro? No Why is this so crazy? Excuse me, excuse me.
[16:37:26] It's crazy ain't it bro? Why is it so crazy here?
[16:37:28] God! Why is it so crazy in the Netherlands? Everybody just insane.
[16:37:32] I don't get it.
[16:37:34] She looks like
[16:37:34] it's crazy here.
[16:37:40] Chat, this boat might sink.
[16:37:42] Oh, it's moving!
[16:37:44] Boat? Where is he at today? Oh, it's moving! BRO!
[16:37:45] Bro where is he at today?
[16:37:56] I'm not about to- y'all stupid as shit.
[16:37:58] I'm not about to jump.
[16:38:04] Let's go, we're about to go over to the boat! Let's go!
[16:38:09] Let's go. We're about to go over to the boat! Bro, we on the boat!
[16:38:12] Chill! Chill! Chill!
[16:38:15] Relax bro, chill! Chill! Chill! right here Bro, this vault about to- bro y'all trippin', bro.
[16:38:29] Hey take the beret, take the beret, bro.
[16:38:34] Chill out, bro! His daughter right here not tripping out, bro.
[16:38:49] Get ass, bro. chill out bro his daughter right here not tripping out bro get ass bro People scared the fuck out of you. You want to go there?
[16:38:53] You can't ask me what I don't wanna do, and I said I don't wanna...
[16:38:55] Bro, check. Don't he like fucking Bernardo Silva?
[16:38:57] He likes a signature from Bernardo Silva. He's like a fat ass. don't you like fucking uh bernardo silva oh my god Goddamn. Speed! High five, man.
[16:39:09] I love you brother.
[16:39:10] Now we got all these people on the same boat.
[16:39:17] Watch out, watch out.
[16:39:21] Speed, speed, speed, speed. Watch out, watch out. Good, good!
[16:39:25] God damn!
[16:39:32] Relax, relax, coma. Chill out y'all, I gotta chill out. It's kids on this bus.
[16:39:37] They got to chill out don't they? They're too crazy.
[16:39:40] They're way too crazy.
[16:39:41] They gotta calm down, man.
[16:39:43] Damn, man.
[16:39:46] Calm down.
[16:39:48] They crazy aren't they bro?
[16:39:50] I'm a black ass man, that's who I am.
[16:39:53] God damn bro!
[16:39:59] Off the boat!
[16:40:02] Off the boat!
[16:40:04] Off the boat!
[16:40:08] Soon!
[16:40:10] Off the boat.
[16:40:13] We made it to the other side! We made it to the other side!
[16:40:15] We made it to the other side.
[16:40:17] We made it to the other side.
[16:40:21] We made it to the other side.
[16:40:24] What the fuck?
[16:40:26] Relax!
[16:40:27] Get out.
[16:40:28] Get up.
[16:40:32] Redeem!
[16:40:34] Redeem! Redeem! redeem Oh I want to go on here What's up, bro? I love you, bro. Yo!
[16:41:07] Call him!
[16:41:08] Call him!
[16:41:09] I'm about to go on...
[16:41:10] Yo, chat!
[16:41:11] Zoom in right there.
[16:41:12] Zoom it up there.
[16:41:13] Speed!
[16:41:14] I'm about to go on a swing up there.
[16:41:16] I'm about to go on a swing up there.
[16:41:17] Chat is he for real?
[16:41:20] Boy, he's lagging.
[16:41:23] Boy, he's lagging. He's lagging.
[16:41:25] I ain't gonna lie bro, he's lagging bro.
[16:41:27] Wait Lil Yachty dropped?! lagging i ain't allowed bro he's lagging bro wait lil yadi dropped
[16:41:33] lyrical lemonade Come on
[16:41:48] Wait, wait Hold wait hold on!
[16:41:50] Is this for Despicable Me?
[16:41:52] Oh I think it is
[16:41:54] It's for Despicable Me
[16:41:56] What the fuck
[16:42:01] Now he got motion!
[16:42:03] Okay, so tell me...
[16:42:06] What are you looking for in a theme song?
[16:42:08] Ooh ooh ooh, that bumble voice!
[16:42:32] He like fights kudos! uh Call the defense! P-po, peepo! Like techno! Like Prianga.
[16:42:34] Okay I got it.
[16:42:36] It's a unique blend of smooth vocals, sick rhymes, powerful bass and that peepo popo flow...
[16:42:43] ...and triangle.
[16:42:45] And a triangle.
[16:42:46] I got the perfect guy for this.
[16:42:49] What's up, Yachty?
[16:42:52] Yachty!
[16:42:53] What are you doing right now?!
[16:42:55] Noooo!!
[16:43:07] H-hello? Hello? Excuse me, excuse me. Yo what the f...
[16:43:11] Yes!
[16:43:13] Yes! Yes! I love this place! Texas Yes!
[16:43:28] Jig is up, I'm back in town
[16:43:30] In my left bank
[16:43:32] You told me around
[16:43:34] I make you smile
[16:44:12] I can touch and see your frown Like a nipple in your mouth like a crown Yeah It's time same time for it I'm back in town You my little me, you follow me around I make you smile, ain't no chance that you fail
[16:44:15] I can look through your mouth like a crown
[16:44:17] The force pull off the ground
[16:44:18] I made out with T-Line Wild like a crown It's a yo chat it's a it's a
[16:44:41] fucking
[16:44:43] a movie it has to be uh it's a movie song
[16:44:46] hold on I'm lagging?
[16:45:01] Why do you think I'm lagging a little bit my piece about a crash
[16:45:05] But if our PC by the fucking crash
[16:45:37] Put the AC on bro.. Yo, why I put up my headphones as low?
[16:45:40] Hold on.
[16:45:42] I might just be buggin'.
[16:45:44] I'm gonna go to bed. I'm just be buggin'.
[16:45:51] I forgot mych is low! Alright, um... all right um hold on let's see there is some bangers got uploaded today chat
[16:46:14] just some bangers got uploaded today chat just some beggars got uploaded today bro Hey! What's up everybody, it's Joe from Complex.
[16:46:51] We're in LA at Soul Stage with star NBA prospect Ronnie James.
[16:46:55] What's up y'all? How y'all doing?
[16:46:56] Gonna do some stuff today to see what he's feeling when he's not and then
[16:46:59] hopefully he's gonna buy some sneakers so let's go Ronnie, I want to take it back.
[16:47:15] You know, first day of school sneakers
[16:47:17] always important for everyone
[16:47:18] but I feel like in the James family
[16:47:20] very important.
[16:47:21] Yeah.
[16:47:22] I found some you and Bryce put Levi's Jordan 4s?
[16:47:25] Yeah.
[16:47:26] So every first thing at school is important.
[16:47:28] That's my Bryce!
[16:47:29] What was that like getting shoes, picking out your
[16:47:30] outfit and stuff?
[16:47:32] Special?
[16:47:33] Yeah.
[16:47:34] You know all the opportunities my dad has given me.
[16:47:36] You know the ability to pick any shoe
[16:47:38] And yeah I went with the Levi's and you know right here it was great
[16:47:41] Something that you said recently,
[16:47:42] one of your favorite solos?
[16:47:45] Little high.
[16:47:45] Vamero!
[16:47:46] Yeah.
[16:47:47] Vamero.
[16:47:48] So are you the type
[16:47:49] that like when you love a silhouette
[16:47:50] like that you'll get every color or...
[16:47:52] I always ask this.
[16:47:53] Chad,
[16:47:53] what's the best joint
[16:47:54] ever?
[16:47:55] You like one color
[16:47:55] and get multiples of it.
[16:47:57] Right now,
[16:47:58] I'm only wearing
[16:47:59] like three
[16:47:59] and it's like
[16:48:01] basic colors
[16:48:02] like black,
[16:48:05] white, tan ones. I'd wear any of these. These are my favorite
[16:48:09] Besides like Air Maxes and stuff Are you like a dunk guy or what are like you feeling now? To be honest, right now it's
[16:48:15] Bomeros.
[16:48:16] A little bit of Dunks in there.
[16:48:19] Some Ones maybe.
[16:48:20] When's the last time you've been in a sneaker store?
[16:48:23] Has it been in a while?
[16:48:28] Probably before COVID. Okay. been in the sneaker store has it been in a while probably before kobe okay so what literally like this is your first time for like five years no yeah wow is it crazy like do you miss that
[16:48:33] do you just go into something man it's kind sneakers for real man? Niggas talk on the line! It's kinda overwhelming. Yeah.
[16:48:36] To be honest, it was just a lot
[16:48:38] to pick from. And then we talked about
[16:48:40] the first day of school pairs
[16:48:42] but do you remember your first good pair when
[16:48:44] you started looking like oh sneakers is a thing that i'm into
[16:48:46] i think it just built as i got older it was just like what can i put together with the fit and
[16:48:51] it's just you know so many shoes you can choose from so as i got older it's just growing with my style.
[16:49:04] Obviously in the basketball section, we talked about
[16:49:07] the process of picking the fits for like regular sneakers.
[16:49:10] But when it comes to ball what's the process then?
[16:49:13] Hmm... It's difficult.
[16:49:15] I bet!
[16:49:17] You know, it's really like whatever I'm doing I bet. It's a lot to choose from.
[16:49:17] You know, it's really like whatever
[16:49:19] I'm feeling that day.
[16:49:20] OK.
[16:49:21] You know, Kyrie's, Cody's.
[16:49:22] We got the best bookies!
[16:49:25] You know, I really just like
[16:49:26] whatever I'm feeling that day,
[16:49:27] I'll put them on and grab them out of the closet and I really just like whatever I'm feeling. How do you not always just go beat?
[16:49:29] Grab them out of the closet,
[16:49:31] and then rock them that day.
[16:49:32] But anything I'm, you know...
[16:49:34] Is there any wear testing in the driveway or...?
[16:49:36] You know what?
[16:49:37] I like to wear shoes till they're, like, beat.
[16:49:39] Okay!
[16:49:40] So I'll wear one shoe for a minute and then switch.
[16:49:43] So I don't really...
[16:49:45] I break my shoes in really well so I'm gonna do all that.
[16:49:48] So there's no half-time switching?
[16:49:49] No. That, no.
[16:49:50] Okay, that's good.
[16:49:51] You know, combine really impressed people.
[16:49:54] Yeah.
[16:49:55] Pro Tro 4 is like Kobe,
[16:49:56] so maybe we'll see these more
[16:49:58] because you had a good performance
[16:49:59] or are you any sentimental,
[16:50:00] these were comfortable.
[16:50:01] I did really well.
[16:50:02] I'll play in these again.
[16:50:03] I mean, I have a lot of them.
[16:50:05] Yeah.
[16:50:06] So, like,
[16:50:07] I've been wearing them for a minute
[16:50:08] but I recently grew out
[16:50:10] of my old ones.
[16:50:11] So, you know, I had to get a whole other collection
[16:50:14] but those are some of the ones that I recently got.
[16:50:16] Another thing about your dad's line
[16:50:18] like the 20 and 21 have specific
[16:50:20] for the next generation,
[16:50:22] which is a nod to you guys.
[16:50:23] Are you helping him wear tests a little bit?
[16:50:25] We were in the lab a little bit.
[16:50:26] I was helping him cook up some stuff for his shoes.
[16:50:30] He wanted to give us like some feedback from his sons,
[16:50:33] which I think helped a lot.
[16:50:34] Definitely.
[16:50:35] It came out of great shoe.
[16:50:37] But yeah, we helped him up.
[16:50:39] And then one thing like out of these,
[16:50:42] do you have a favorite
[16:50:43] or it's just what you're feeling at the time
[16:50:46] of his shoes?
[16:50:48] My favorite bronze.
[16:50:49] Yeah.
[16:50:50] The plain,
[16:50:52] Like the ones for me, like...
[16:50:53] First ones! New generations!
[16:50:55] I love playing in those. They're super light.
[16:50:58] Yeah.
[16:51:00] But the 20s too, you can never go wrong.
[16:51:03] I mean, help make those stuff.
[16:51:05] Yeah so they're geared to you.
[16:51:08] Obviously you are young 2010 crazy, crazy release.
[16:51:12] I think you were six?
[16:51:13] Do you know about like how crazy these
[16:51:16] were when they first dropped?
[16:51:17] I don't know about like how crazy it was
[16:51:19] but I do know that I had a couple pair of them
[16:51:23] and I wore them pretty frequently
[16:51:24] and so I played with them a lot. W-N-O!
[16:51:26] So these were like, you know,
[16:51:27] Yeezy level.
[16:51:29] Like, I was at Complex
[16:51:29] and when these dropped
[16:51:30] it was like people
[16:51:31] all around New York City.
[16:51:33] Yeah.
[16:51:33] Crazy.
[16:51:34] This is probably...
[16:51:35] You know, they re-released
[16:51:36] but this was such a moment 2010 South Beach LeBron's
[16:51:39] Another thing I want to talk about it is how fun is it?
[16:51:42] To get like PEs
[16:51:45] Especially when I got the ones with the six on the back yeah it was geeked out
[16:51:53] it's like kind of like you know dion sanders has the quote
[16:51:56] play good so like when you have PEs is the feelings different?
[16:51:58] Because like you said I'm wearing a shoe that's only made for me.
[16:52:02] Yeah it was different. It's a different feeling
[16:52:04] that gets you hyped.
[16:52:13] As many shoes that you have seen come and go, is there one
[16:52:15] that you haven't got yet or no? Or that
[16:52:17] one that you chased for a while.
[16:52:19] Um, the one CPFM, the Air Force's influence
[16:52:24] I wanted to go look at it.
[16:52:26] What the fuck?!
[16:52:29] So you don't make me send all this shit? fuck
[16:52:33] so you don't make me send me all this
[16:52:34] shit
[16:52:39] so i know he got all this yeah i I know he got all that shit,
[16:52:42] like his crib is just full with Nike!
[16:52:44] Okay, one shoe that we both share a love of?
[16:52:52] Black Cat 4s are so good. Black Cat 4s?
[16:52:53] Yeah, yeah.
[16:52:53] So these probably I love the bread four but
[16:52:56] these are like a close second for me.
[16:52:58] What do you love about those?
[16:53:00] Being able to go with anything.
[16:53:01] Anything.
[16:53:03] They look nice,
[16:53:04] they look really good.
[16:53:05] Oh my God, so good!
[16:53:06] Yeah, just...
[16:53:07] So fucking good!
[16:53:08] Can't beat them.
[16:53:09] You can't beat them, yeah.
[16:53:09] And you know,
[16:53:10] you said that you like
[16:53:10] to beat your shoes,
[16:53:11] the other thing is buttery suede but they also wear really well.
[16:53:15] Yeah yeah yeah.
[16:53:16] This amazing shoe.
[16:53:17] I've had many pairs of these.
[16:53:18] Okay so you replaced these even?
[16:53:19] Yeah yeah yeah.
[16:53:20] Such a great shoe.
[16:53:21] So good!
[16:53:23] Oh god! We got this. Such a great shoe. So good! Oh, God!
[16:53:25] We're going to his angle on that.
[16:53:27] That's all I need.
[16:53:29] Another thing at Complex,
[16:53:31] high school graduation...
[16:53:32] Wow, these are small.
[16:53:36] But every time we post this photo it goes crazy.
[16:53:39] What was the decision to wear Phantoms?
[16:53:42] Travis Scott won.
[16:53:42] It was just the mood that day.
[16:53:44] I had the black jeans
[16:53:46] that I had that day
[16:53:46] and, you know,
[16:53:48] can't go wrong with black.
[16:53:49] Like the black hats.
[16:53:50] Yeah,
[16:53:51] I just felt like
[16:53:52] putting them on
[16:53:52] and it looked good.
[16:53:54] Definitely.
[16:53:54] This guy would be like a size six
[16:53:56] in there his hand covered the whole thing
[16:53:58] but it goes to that black suede
[16:54:00] and its like a lot more casual shoe.
[16:54:03] Who would you say is
[16:54:04] the biggest sneakerhead in the family?
[16:54:05] Does dad count or is there anyone who's more into,
[16:54:10] Or all equally.
[16:54:12] I think we all try to get ours and And Bryce, he researching for sure.
[16:54:16] OK.
[16:54:17] Yeah, yeah.
[16:54:18] That boy's Bryce!
[16:54:19] W-Brice!
[16:54:20] Happy birthday.
[16:54:20] Happy birthday while we're filming?
[16:54:21] Yes sir.
[16:54:22] You said you know all of the cactus plant
[16:54:24] is like your reason but Bryce is like researching.
[16:54:26] He's on go trying to find everything, yeah.
[16:54:28] Okay.
[16:54:29] Another thing...
[16:54:30] I think you're a 14.
[16:54:32] Dad's a 15.
[16:54:33] Are you ever double-socking
[16:54:35] to wear shoes that he...?
[16:54:36] I did one time.
[16:54:37] What shoe?
[16:54:37] Do you remember what it was?
[16:54:39] Was there a rare one?
[16:54:40] It was the off-white Hyperdunks
[16:54:42] Okay.
[16:54:43] That I wore,
[16:54:44] I played in them and I fell so
[16:54:45] Really?
[16:54:46] Yeah,
[16:54:47] And they actually fit pretty well So, if your foot grows a little more
[16:54:50] you have all access like that
[16:54:52] so you can really get whatever you want.
[16:54:53] That'd be great.
[16:54:55] I would love to size up one
[16:54:57] and get somewhere else.
[16:54:59] Yeah, yeah.
[16:55:00] Better than this store probably.
[16:55:02] We got a talk a week away
[16:55:04] this week that is running.
[16:55:06] NBA draft.
[16:55:07] How excited are you
[16:55:08] for like that next chapter of your life yeah
[16:55:12] hey is he the like it's most likely the nice job right
[16:55:19] a blessing my dreams are finally coming true A blessing.
[16:55:22] My dreams are finally coming true.
[16:55:23] Oh my fucking gosh, boy. It's a grateful opportunity that I just, you know...
[16:55:26] Wait!
[16:55:26] LeBron wants to play with his son?
[16:55:28] Or does he want to play...
[16:55:29] Like, does he just want to play a game?
[16:55:30] Like, against him or some shit.
[16:55:32] He wants to play with him right?
[16:55:40] Bro how legendary is that gonna be bro?
[16:55:42] That first game chat.
[16:55:44] Chat that first game bruh!
[16:55:48] Take advantage bro.
[16:55:49] Yeah all rooting for you again.
[16:55:51] Life's about to change but yet to do what we love on the court
[16:55:56] congratulations how much other things gonna go talk about everything now is
[16:55:59] an easy part browser shelves see we're gonna take home I see what he caught, the PWL.
[16:56:15] Bro, what can I get for you today?
[16:56:17] I've been looking for these.
[16:56:19] The pink ones are really good with a bit of color but
[16:56:22] then the white and the green one's looking good too so I might just get out there
[16:56:28] and come on.
[16:56:29] Come on?
[16:56:30] Yeah.
[16:56:31] W!
[16:56:32] Man, I've been seeing these they look crazy when they start peeling.
[16:56:33] Yeah the colors.
[16:56:34] Yeah how many of these two? For sure. Eh! look crazy when they start peeling. Yeah, the colors.
[16:56:35] Yeah, I'm gonna need these too.
[16:56:36] For sure.
[16:56:39] It's my brother's birthday.
[16:56:41] I've been looking to get him some shoes.
[16:56:44] And I think those two up there have I've been looking for some Kobe's myself.
[16:56:46] We're the same size so you know
[16:56:48] I can wear them sometimes
[16:56:50] so I'm gonna get those up there.
[16:56:54] I beat these crazy when I was young.
[16:56:58] That's a good one.
[16:56:59] Yeah, I need another one of these.
[16:57:01] Matter of fact, y'all got any more off-wise?
[16:57:03] Yeah, we got some more in the back.
[16:57:04] We can pull them out.
[16:57:05] All right.
[16:57:05] All right.
[16:57:06] Go, go, go.
[16:57:09] Oh! You think Colton's coming? I don't know. Oh shit!
[16:57:10] OH SHIT!
[16:57:12] Find everything okay?
[16:57:13] Yes sir, yes sir that's what i'm talking about
[16:57:17] So your total is $10,172 with 55 cents.
[16:57:20] All right brother.
[16:57:21] Yes sir.
[16:57:23] All right everything good.
[16:57:24] Hey Kitty come on man help me with this.
[16:57:28] You ain't gotta worry about it today, gotcha?
[16:57:29] Taking this to the car for you my boy.
[16:57:31] Sir.
[16:57:33] Appreciate it.
[16:57:40] Love you. W W
[16:57:42] W
[16:57:44] W
[16:57:48] Nice!
[16:57:49] W Ah Nice. W. 5 5
[16:58:07] Yo my stomach feels crazy chat
[16:58:11] My stomach feels crazy chat.
[16:58:14] My stomach feels crazy.
[16:58:17] Speed up let me see, let me see hold on.
[16:58:20] Oh shit.
[16:58:26] Oh my stomach feels crazy bro. my god i'm scared yo recorders off your phone too
[16:58:37] i think i think you should get like right where she's like yeah Yeah. Oh, we push it.
[16:58:39] The core like right where the slip's at.
[16:58:42] Be right about to slip's not here we go
[16:58:50] oh uh yeah you cannot use your phone on this thing Bullshit! You going by yourself? Uh, yeah.
[16:58:54] You cannot use your phone on the thing man.
[16:58:56] Okay alright.
[16:58:58] Here just record it for me.
[16:59:00] No no no make sure he met you right here next to slips.
[16:59:03] Oh my god oh my god! Oh hell no. Hey man, you right here. Right next to slips. Alright take a seat.
[16:59:05] Oh my god!
[16:59:09] What the fuck? What do you mean?
[16:59:11] Oh like this.
[16:59:16] Oh shit! Oh shit!
[16:59:20] Oh shit! Fuck you mean enjoy?
[16:59:24] What photo? How no!
[16:59:26] Ohhhh!
[16:59:28] Oh no, don't swing it!
[16:59:30] Oh no, don't swing it!
[16:59:32] Oh shit!
[16:59:34] Holy shit! Oh my god!
[16:59:37] Oh my god I can't even look bro
[16:59:41] Oh shit
[16:59:43] Why are you a fuckload?
[16:59:45] Oh shit! Bruh nooo
[16:59:48] Oh my fucking god dawg
[16:59:50] Oh my god
[16:59:52] Oh my god
[16:59:56] Get off!
[16:59:58] Oh my god
[17:00:00] This shit is nice actually as fuck
[17:00:02] Oh my shoe, my shoe, my shoe
[17:00:04] My shoe, my shoe
[17:00:06] My shoe OH NO shoe! Oh no!
[17:00:09] My shoe too!
[17:00:11] My shoe!
[17:00:15] Damn look!
[17:00:17] No they stealing my shoe! shoe. Oh my god!
[17:00:20] Get those slips!
[17:00:22] Slips, they still in my fucking shoe.
[17:00:24] No! They still
[17:00:26] in my shoe!
[17:00:28] Oh my God bruh! Oh my God, bro Oh my god
[17:00:30] My shoe just fell
[17:00:31] Oh my god
[17:00:32] No, get me off this shit
[17:00:33] Get me off this shit
[17:00:34] Stop it, man
[17:00:35] Stop, yo
[17:00:35] Stop this shit
[17:00:36] Fuck
[17:00:37] They're fighting for your shoe
[17:00:38] Bro, they're fighting
[17:00:39] For my shoe Bro, they're fighting for my shoe!
[17:00:41] Bro, they stole my shoe.
[17:00:45] Oh my god...
[17:00:47] They actually just stole my shoe bruh.
[17:00:49] Oohh bro, my feet ashy and shit!
[17:00:51] Yo what the fuck?!
[17:00:53] God no! Back it up!
[17:00:55] Back this shit up.
[17:00:57] This is crazy only sick fucks do this.
[17:01:01] Oh my god I don't got a shoe my feet look disgusting
[17:01:07] no bro hey bro give me my shoe nah bro they gotta get my shoe back bro. Where's my food at?
[17:01:17] You got my food?
[17:01:19] No, they got my shoe down there!
[17:01:21] Yo whoever That was down there. Yo, whoever yo, whoever
[17:01:23] They took my fucking shoe
[17:01:32] Yo, what the fuck?
[17:01:36] I'm good. I'm good.
[17:01:39] Oh! Oh you stuck!
[17:01:48] I got him. Chat, chat. All day they're going to give it back. We are?
[17:01:49] We're out.
[17:01:50] We're out.
[17:01:51] We're out.
[17:01:52] We're out.
[17:01:53] We're out.
[17:01:54] We're out. We're out. We're out.
[17:01:58] Can we hurry up and get the elevator? Gotta hurry up.
[17:02:00] That shit's off.
[17:02:04] Yo, why is this beat so nasty, Chan? I think I'm gonna fucking shoot. Fuck, G.
[17:02:07] I don't know where to fucking shoot.
[17:02:09] Fuck.
[17:02:13] Yo, whoever stole my shoe that's in the stream......I'll give you 500 euros if you gave me a shoe back.
[17:02:16] 500 euros. You get my shoe back. 500 euros.
[17:02:17] You get $500, bro. I would
[17:02:19] give you $500 for the person...
[17:02:21] Because I know you're in a stream right now and I know you're watching the stream.
[17:02:24] For whoever the Netherlands person
[17:02:25] is in a stream right now, I would give you 500 euros.
[17:02:28] They're about to fight over that shit!
[17:02:29] 500 Euros bro!
[17:02:30] They're about to fight over it!
[17:02:35] But...
[17:02:37] Really? No, I- but really?
[17:02:44] they're fighting, they said they were fighting
[17:02:47] no way they are fighting. I don't know what they're actually fighting about.
[17:02:49] You got the ferry now?
[17:02:51] Huh? There!
[17:02:57] It's only right back from New Zealand. Yeah Yeah, no I know. Um... do we know who will fight us?
[17:03:00] Fuck!
[17:03:02] It's a back-to-back team. They're probably... fuck.
[17:03:07] Something happened.
[17:03:08] They are fighting. I have it. I have it. chat. Yo Kevin get my shoe back
[17:03:12] Alright man tell you about to get our shoes back
[17:03:15] Where's my shoe at?
[17:03:17] Where's my shoe?
[17:03:19] Put away the shoe, I gotta get my shoe
[17:03:21] who got the shoe?
[17:03:23] Who got the shoe?
[17:03:27] Where did it drop, this way yeah?
[17:03:29] Yeah it dropped this this way. It's up this way.
[17:03:31] Can we go in the back of this?
[17:03:32] It's an orchestra.
[17:03:34] What is that sound?
[17:03:39] Look at these zombies!
[17:03:44] Shut up! Zombies? Hey, where my shoe at?
[17:03:48] Zombies, zombies, zombies, zombies.
[17:03:55] His mic!
[17:03:57] Look at your mic!
[17:04:01] ... I gotta get my shoes. Put it right, put it right.
[17:04:16] Guy, you ready for a... What?
[17:04:19] No no no what?
[17:04:21] Everybody on this way.
[17:04:26] No sound, no sound no sound it's like a zombie apocalypse wait i gotta get my shoes
[17:04:43] yeah we got to go on the boat wait i'm gonna get
[17:04:44] my shoe i think one of them got my shoes
[17:04:46] Yeah what the fuck?
[17:04:50] Yeah they got one too. Go! Go! Go! Go! Go! Go!
[17:05:17] Oh my god, Help, Slips!
[17:05:18] HELP! NOW SLIPS! NOOOOOO!!!
[17:05:26] Wait for the buzzer to take it to prison, shit. Oh shit!
[17:05:40] We lost him bro.
[17:05:42] We lost him, we lost him.
[17:05:44] Oh fuck.
[17:05:46] Oh shit.
[17:05:48] Oh shit.
[17:05:50] Wait. Watch out yo watch out, jeez. Watch out y'all! Watch out! Watch out!
[17:05:52] Wait, come on!
[17:05:56] Come on!
[17:06:01] Come on! Watch out! Watch out, timeout Timeout
[17:06:03] Watch out
[17:06:05] Timeout
[17:06:33] Timeout oh oh Watch out! Watch out! Watch out! You're the son of a...
[17:06:39] Bro, bro. Watch out! Watch out!
[17:07:11] Watch out! Watch out! watch out watch out i don't know Speed, fight! Fight it, fight!
[17:07:37] Speed, I fight! I need to get off! Nooo! Oh my feet! Oh shit. Hey, hey!
[17:07:48] Watch out, watch out!
[17:07:50] Watch out, watch out!
[17:07:52] Watch out!
[17:07:54] Watch out!
[17:07:56] Move! Move! Move! B-bark!
[17:08:00] Oh shit!
[17:08:04] Bark!
[17:08:06] Bark! BARK! BARK!
[17:08:13] Oh my fucking gosh, broy.
[17:08:14] What the f- We got one more!
[17:08:16] Watch out!
[17:08:18] Bro I can't breathe bro.
[17:08:21] I didn't even know there was gangs in the Netherlands!
[17:08:24] Them niggas throwing up blood and shit!
[17:08:26] Them niggas throwing up all types of gangs!
[17:08:28] Look! What the fuck? I didn't even know they had thoughts
[17:08:37] bro
[17:08:41] oh my god Bro! Oh my fucking gosh
[17:08:49] Chess is on the lens, this is Europe.
[17:08:57] Bro we love you bro from Turkey!
[17:08:59] We love you from Turkey!
[17:09:01] Bro we love you from Texas! I gotta see you bro, watch out!
[17:09:02] Bro we have to know that we have to love you from Turkey yeah?
[17:09:06] Watch out!
[17:09:12] This shit crazy.
[17:09:16] Bro, what the fuck?
[17:09:19] Move, move!
[17:09:22] Bro we gotta go somewhere else. Take my shoes bro! oh oh Oh!
[17:09:50] Well, he got an N.
[17:09:52] He's going to have to end it, bro.
[17:09:55] It's going to get worse.
[17:09:58] Oh, my fucking God.
[17:10:01] Get the fuck out of the way! Fuck! I just did! I just did!
[17:10:21] I just did!
[17:10:25] Ah, fuck. Yo guys, you gotta stop this shit.
[17:10:28] Yo guys, guys, come on!
[17:10:34] Watch out, watch out.
[17:10:53] Watch out, watch out. What's up? Guys, move, man. I got no shoes on!
[17:10:55] It's crazy!
[17:10:57] I can't even move! I gotta do it! crazy Hey, hey! Watch your shoes!
[17:11:10] Come on.
[17:11:14] Watch out.
[17:11:22] No, we got it. We got to go. We got to go.
[17:11:25] We got to do it.
[17:11:28] We got to do it. is Oh, he's got the police! Chill out! Chill out now!
[17:11:44] Chill!
[17:11:54] Just hold on. Move it, guys. This boat not moving because there's people still stuck on it.
[17:12:01] You better off just get off the boat bro!
[17:12:04] Oh my god, it's less than one hour.
[17:12:06] This is long ass.
[17:12:10] I don't see it!
[17:12:14] I don't see it! I just feel! I just feel! I just feel!
[17:12:22] Watch out, watch out! Watch out, watch out!
[17:12:27] No we gotta go, we gotta go.
[17:12:33] I don't think it should go on.
[17:12:35] Bro, the boat is not moving.
[17:12:38] I can get you a place man!
[17:12:43] I can get you a place.
[17:12:46] I can get you a place. I can get you a place. I can get you a place.
[17:12:52] If we go out,
[17:12:54] we'll be rushed. No!
[17:12:59] Let's go back to the back of the corner and call it a day.
[17:13:21] Stay on the boat. Go to the building and scream then get the fuck up outta there bro. Wait, wait, wait.
[17:13:37] Go on the back! Go on the back.
[17:13:47] Oh, my fucking God, bro!
[17:13:49] This shit is crazy!
[17:13:52] Yo, yo, yo, guys!
[17:13:55] Give me a second. I'm with you on this one. guys is We can get on that boat right there. We can get on that boat.
[17:14:25] Yo, we can get on that boat. We can get on that boat.
[17:14:50] No I need to get on that boat. I'm not the one. Yo, yo, can you go this way? Why boat?
[17:14:53] Can you please go over there?
[17:14:56] Can you drive the boat over there?
[17:14:58] Why?
[17:15:00] Do we gotta get off this boat?
[17:15:02] They got boats for us.
[17:15:04] Hey! We gotta get off this boat. They got boats for us! Get up, hey!
[17:15:07] What?
[17:15:10] Come right here! Come right here!
[17:15:11] Hey it's my boat!
[17:15:12] Where can we get on?
[17:15:13] Where can we get on?
[17:15:14] Hey boys let me talk to them.
[17:15:20] Park here!
[17:15:22] Come here!
[17:15:26] He got my shoe, he got my shoe.
[17:15:28] Zoom in on him!
[17:15:30] You go there yeah?
[17:15:32] I'm sorry for that.
[17:15:34] Oh you have the shoe?!
[17:15:37] Watch out watch out. I knocked it. Oh you got a shoe! I'm stuck here
[17:15:41] I might as well just jump on that shit bro
[17:15:45] Watch out watch out I could just jump on that thing.
[17:15:48] Get right here!
[17:15:52] Come right here!
[17:15:56] Come right here! Come right here!
[17:15:58] Come right here, so I can get on!
[17:16:00] Bro what the fuck is going on? Come out here so I can get on a boat.
[17:16:02] You have to swim.
[17:16:04] Swim.
[17:16:06] I'm so dumb.
[17:16:09] I'm so dumb. I'm dumb. Come right here!
[17:16:11] I can't get right there
[17:16:13] I'm so dumb
[17:16:17] Come right here Come right here!
[17:16:22] Come right here. It's the only way, bro.
[17:16:24] It's the only way.
[17:16:26] Come right here.
[17:16:30] No, we can't go back!
[17:16:34] I can't. Don't go right there
[17:16:40] Stop! I'm sorry. Come on here, come on here, come on here! I gotta get over there. I got to get over there.
[17:16:41] I got to get over there.
[17:16:42] I got to get over there.
[17:16:43] I got to get over there.
[17:16:44] I got to get over there.
[17:16:45] I got to get over there.
[17:16:46] I got to get over there.
[17:16:47] I got to get over there.
[17:16:48] I got to get over there.
[17:16:49] I got to get over there.
[17:16:50] I got to get over there. I got to get over there. I got to get over there. Come right here! I'm straight, I'm straight.
[17:16:52] Come right here!
[17:16:54] I gotta get off bro.
[17:16:56] COME RIGHT HERE! Watch out!
[17:17:02] Let's go, Speed. Let's go, Speed.
[17:17:04] There we go.
[17:17:24] Go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go, go go go go no no no no no no no no wait slip slip One more, one more! Slips though! We gotta get slips!
[17:17:28] Yo pick up my friend!
[17:17:32] No no no no no no!
[17:17:34] We got you.
[17:17:36] Pick up Slip!
[17:17:38] Hey yo, pick up!
[17:17:40] Yo, pick up Slip!
[17:17:42] Yo, take his opener,. Take us over there.
[17:17:45] Alright.
[17:17:47] Hey yo!
[17:17:49] Yo, hey!
[17:17:51] Yo, yo, yo, yo...
[17:18:06] We got you. You know who is that? Who is that?
[17:18:08] Slip
[17:18:12] Let me go
[17:18:17] Who is this? Fuck that nigga!
[17:18:21] Let's go!
[17:18:25] Bro who is this bro?
[17:18:28] Yo bro what are you?
[17:18:30] No!
[17:18:34] Yo take it to the shore
[17:18:36] Take it to the shore Take it to the shore! Take it to the shore!
[17:18:38] Take it to the shore, take it to the shore
[17:18:40] Who the fuck is that?
[17:18:42] Yo don't drive into that bro
[17:18:46] What do you mean? Don't drive into that fat ass boat right there!
[17:18:49] Don't go with no police, don't go with no police.
[17:18:53] Why'd you get on the boat?!
[17:18:55] I was supposed to help him before!
[17:18:59] My fault.
[17:18:59] My fault.
[17:19:00] My fault.
[17:19:00] My fault.
[17:19:01] My fault.
[17:19:02] Okay, alright.
[17:19:03] Okay, alright.
[17:19:03] My fault.
[17:19:04] I'm just saying because it's too much shit.
[17:19:06] Can I say one thing bro?
[17:19:07] What?
[17:19:08] On the water you're safe. We can bring you through all of Amsterdam-
[17:19:10] WHAT THE FUCK IS THAT?!
[17:19:11] IT'S NOT A DEAD ANIMAL?!
[17:19:12] That's the fucking animal!
[17:19:13] Oh no...
[17:19:14] You can do the best thing that you can do now...
[17:19:17] Bro just take-
[17:19:19] No no no, you gotta take us over there. Bro, just take... Bro, take his boat.
[17:19:22] Yo, yo, yo, you gotta take his over there.
[17:19:23] No, we don't go in there.
[17:19:24] We're going to a different port.
[17:19:27] Bro, I'm in the middle of an ocean on this cheap-ass boat.
[17:19:28] I'm scared.
[17:19:30] But I'm scared though, bro.
[17:19:33] Like, I don't like boats, like both this boat's scary as fuck
[17:19:36] Shit tip initiative. Oh, I don't want this to fall
[17:19:42] So they move when I leave even the police police is right there. Oh my god, no no! Bullshit! Go go!
[17:19:44] Go! Oh my fucking God, go!
[17:19:46] Go! Speak this shit up!
[17:19:50] Oh my fucking god!
[17:19:55] No, I don't wanna crash.
[17:20:01] You guys want some beers? What the fuck is going on?
[17:20:08] No, bro. I wanna go home
[17:20:12] We cannot go to this port.
[17:20:13] They are going to the port.
[17:20:19] Wait, Slips can I see your phone?
[17:20:22] Not this one. Can I see your phone?
[17:20:29] Gee, can you...
[17:20:32] It's too much shit going on bro. Almost die we in the middle of ocean and shit bro.
[17:20:37] Yeah bro please no seriously the police is coming i don't know if you know
[17:20:39] speed who this fuck are you dumb
[17:20:40] yeah bro like the police
[17:20:41] are you fucking dumb
[17:20:42] I wish the police should have been here
[17:20:43] what do you mean who is fucked is he gonna be talking about
[17:20:46] are you fucking dumb?!
[17:20:49] Yo, police! Come here my friend.
[17:20:51] My friend, they're going to arrest you.
[17:20:53] No, no, Speed, no, they are going to arrest you.
[17:20:55] Just tell them we're going to do
[17:20:59] excuse me sir sir excuse me so look I'm gonna wait
[17:21:05] i'm trying to explain to you like what's going on and what's happening.
[17:21:10] We go through the side of the water because our safety is better there than here.
[17:21:15] Okay, alright.
[17:21:17] But look can I explain to you on what's going on though I love you man
[17:21:33] I'm just trying to explain what's going on bro
[17:21:35] That's all i'm tryna do
[17:21:37] We need this guy shoot
[17:21:39] We need the shoot bro. Don't worry.
[17:21:40] We need the shoe.
[17:21:41] The shoe!
[17:21:42] That is not his shoe though.
[17:21:43] That's not his shoe.
[17:21:45] That is my shoe.
[17:21:47] Wait that's my shoe.
[17:21:49] Wait that's my shoe! That's my shoe!
[17:21:50] No I had a grey one.
[17:21:56] He stole my shoe officer
[17:22:01] Nah he didn't steal it You stole my shoe. He stole my shoe and I'm... Explain me please, who are you?
[17:22:03] Okay, I am a
[17:22:05] Wait listen
[17:22:07] I'm like a famous football player
[17:22:09] And I'm a famous stream player and I'm a famous streamer. You know Cristiano Ronaldo?
[17:22:12] That's my...I'm Ken Helm, and I do YouTube
[17:22:16] And all these Netherlands German Dutch people coming after me
[17:22:19] Speed speed! I'm like calm down calm down get off the way
[17:22:21] They're just coming out of me Like basically
[17:22:23] I'm like Ronaldo's son
[17:22:25] I swear to God
[17:22:27] What type of football?
[17:22:29] What type of food bell?
[17:22:31] Oh Portugal For Portugal national team What type of football? What type of food, Bill? Football.
[17:22:32] Oh!
[17:22:33] Portugal for the national team.
[17:22:34] For the Euros.
[17:22:35] I played for the Euros and all these people was going crazy.
[17:22:38] Can you please help me out bro?
[17:22:41] Yo yo yo.
[17:22:44] So basically officer we were on the street
[17:22:48] too many fans so we tried to get on the boat
[17:22:50] and they just bombarded us
[17:22:52] and had to jump on this to get away from it. They wouldn't let us in, they couldn't get out so...
[17:22:58] What he has to do now is... Look, this one is right here, it needs to go.
[17:23:02] He's going to ram boats over there and then everyone will jump on the boat.
[17:23:05] So for his safety, they jumped on this boat and went over there.
[17:23:09] Look, everybody is ready now.
[17:23:13] Yo sir!
[17:23:16] Yo sir, my b-class is over there.
[17:23:18] Yeah. Can you bring me
[17:23:20] over to my V-Class, sir?
[17:23:22] My van is over there, sir.
[17:23:40] The black car. over there sir Wait, I'm... This shit's crazy.
[17:23:42] Nah, bro, nah, nah.
[17:23:46] Sir, is it possible to stop the YouTube channel for now?
[17:23:50] Oh...
[17:23:52] Yeah, yeah.
[17:23:53] For our safety.
[17:23:55] Alright.
[17:23:56] Not everyone gets around and knows where you are.
[17:23:57] Okay I got you.
[17:23:59] Yeah it's a bit too late everybody is looking at us like...
[17:24:03] It's like...
[17:24:14] Good shit, chill bro! Yeah Yeah Bro, watch out for this boat bro
[17:24:18] We're the local boys and we know what's going on.
[17:24:21] I just don't want to crash into them guys.
[17:24:24] How are you doing?
[17:24:29] This is crazy, man. I told you.
[17:24:32] Bro, Netherlands is cra-
[17:24:34] I don't think I ever been somewhere
[17:24:36] I don't think I've ever been somewhere where
[17:24:43] A lot of people like it I don't think I've ever been somewhere where... This is the craziest country I've ever been.
[17:24:48] My B-class is over there!
[17:24:52] My corn's over there. The way he went, stupid.
[17:24:54] Oh my God!
[17:24:58] In the moment you got too much shit going on.
[17:25:08] Yeah. They have too much shit going on. Who is the driver?
[17:25:12] It's 1, 2 and 3.
[17:25:15] Let the driver drive to I-Doc 5.
[17:25:18] That's the road up here.
[17:25:20] Okay, good.
[17:25:22] What did he say?
[17:25:24] Let the vehicle drive to a location like
[17:25:26] Eindhoek 5
[17:25:30] Listen
[17:25:34] You need to go to Eidoc. You need to go to Eidoc. Yeah, you need to call the driver.
[17:25:38] Why can't we just...
[17:25:39] We better off just get into the D-class and just rob an off-road vehicle.
[17:25:45] Eidoc? It's just robbing off the people. And the people won't know why we're dropping people. Uh, I don't...
[17:25:47] Tell them we better get to the B class now
[17:25:49] which is robbing off.
[17:25:53] This is a police station, it's okay there.
[17:25:55] Oh so police stations?
[17:25:57] No they're just small police stations that help policemen.
[17:26:00] Oh ok.
[17:26:02] Just to be safe right?
[17:26:05] Then we gonna go with this?
[17:26:10] But, Portugal...
[17:26:19] Bro you don't know what I just went through bro. I couldn't even breathe.
[17:26:22] It is stopped.
[17:26:25] The camera's down. I live stream is stopped.
[17:26:28] The camera's down.
[17:26:30] I know, the camera's down and it stopped.
[17:26:32] That what I'm trying to tell you.
[17:26:34] Yeah but the camera's down and it stopped.
[17:26:36] No, it's muted.
[17:26:42] Okay, it's muted. They don't know where we're going what's this last thing sir yes
[17:26:46] yeah it's muted they can hear they can't really i want to see
[17:26:49] what do you mean you want to see it It's muted Bro I didn't Bro, I did not know.
[17:27:03] Holy fuck.
[17:27:04] What's the...
[17:27:04] Chad, what's the crazy...
[17:27:06] Is this the craziest country in Europe?
[17:27:07] Or it gets crazier?
[17:27:08] There's no way.
[17:27:12] What the fuck?
[17:27:18] I feel like
[17:27:18] London is fucking insane, bro. I feel like London is fucking insane bro.
[17:27:21] I feel like London, bro.
[17:27:23] I feel like London is fucking crazy.
[17:27:28] Oh they're gonna arrest him.
[17:27:30] They're going to arrest him. I'm telling you right now
[17:27:33] they're going to arrest him
[17:27:47] For what?
[17:27:48] Just to make like
[17:27:49] They're gonna just do it
[17:27:50] To bring them in and shit
[17:27:52] Like that get more info
[17:27:54] Ggs
[17:28:04] Ggs oh shit GG's. Oh, shit!
[17:28:14] Hold on let me text him. I'm me text him.
[17:28:22] Let me make sure he's okay bro.
[17:29:00] Make sure... hold on after make sure he's okay bro make sure after. Hello? Free my nigga speed man!
[17:29:33] Free my nigga speed, bro! oh my goodness bro chat what the yeah why that yeah we bought everybody we're gonna hop on the game and i'm gonna hop on again but i want to make sure he's okay though
[17:29:37] well you really look tight bro.
[17:29:48] I want to make sure he's okay first.
[17:29:50] God damn.
[17:30:15] Okay.. Can you close my mind?
[17:30:24] Okay, let me know. Hold on, hold on, hold on. Hold on, chat.
[17:31:02] Oh my gosh, bro.. Oh my gosh. So you think if I did a festival, like a music festival
[17:31:40] I could make my money back?
[17:31:45] Like
[17:31:46] You think those are very good for making your money back and shit? I want to try one.
[17:32:01] I'm going to try one.
[17:32:02] I'm going to try one.
[17:32:03] I want to try one, bro.
[17:32:05] I want to try one.
[17:32:06] I just want to try one.
[17:32:09] And I want it to be fire like Oh my god
[17:32:11] What about that
[17:32:13] Kotti headlining
[17:32:15] What about that
[17:32:17] Wait Aroki I'm not lying.
[17:32:19] Wait, I lowkey...
[17:32:20] Oh my God, hold on.
[17:32:21] How much you think that nigga get booked to festival chat?
[17:32:27] I know some artists will do it off the strength.
[17:32:29] I know some artist would do it off the strength. I know some artists that do it off the strength, bro.
[17:32:34] I know some artists that do...
[17:32:36] WAIT CHESTER! THEY ACTUALLY DO IT IN 2025?! What's he doing in 2025?
[17:32:54] What should I call it though? I should just call it stream fest, huh
[17:33:01] Or KC Fest.
[17:33:02] KC Fest!
[17:33:10] A&P Fest? It could be A&P Fest if A&P helping me with that money.
[17:33:16] If my niggas helping me with that money
[17:33:20] I think im one of the craziest motherfuckers thats gone
[17:33:23] Oh my god, oh my god.
[17:33:24] Almost fell and busted my ass.
[17:33:29] Almost fell.
[17:33:32] But the production gotta be on some Amazon Prime shit right?
[17:33:34] Streamed and everything. That shit got to get streamed,
[17:33:37] Right from the channel. Oh my gosh!
[17:33:40] You guys will love that shit!
[17:33:43] I think I would do a KC Fest, right?
[17:33:46] And I'm gonna have all y'all favorite streamers hosted
[17:33:48] so like any side interviews and shit like that
[17:33:54] it'll be by fire streamers and shit like that.
[17:33:57] And then, remember I'm saying this bro!
[17:33:58] Remember I'm saying this chat.
[17:34:00] Remember I'm saying this.
[17:34:01] At first I wanted to do it with Aiden
[17:34:05] but I don't think anybody wants to do it
[17:34:06] So
[17:34:06] You feel me
[17:34:08] And it's very expensive
[17:34:10] So if I'm paying a lot of money
[17:34:12] If I'm paying a lot of money
[17:34:14] I might have to just do them on my own
[17:34:15] Can we get arrested Get arrested I paid a lot of money, I might have to just do it on my own.
[17:34:19] Did he get arrested?
[17:34:54] Oh my god... What the fuck? Well, people would have said I was saying L-end.
[17:34:56] Like what? Wait, did he end? What?
[17:35:02] Wait, did he end?! How did he end it? I think he ended.
[17:35:12] Wait no, he didn't. Hold on. chat chat chat i got a question question.
[17:35:34] Oh, that's why! Where would I do this festival at though?
[17:35:38] On to the next man
[17:35:40] Love y'all boys bro.
[17:35:42] Let's see how it begins
[17:35:50] Oh, NYC?
[17:35:55] I think i can do it chat! I think i'll be able to peel it off.
[17:35:57] I actually think i could do it.
[17:35:59] I-I actually think i could do a KC Fest bro
[17:36:03] No,
[17:36:03] I think that I can do it!
[17:36:04] Oh my god
[17:36:05] I'm thinking about it right now
[17:36:06] Hi,
[17:36:06] My name is Speed
[17:36:08] AHHHHHH
[17:36:10] Uh
[17:36:10] Uh,
[17:36:10] Speed?
[17:36:11] Speed turn around
[17:36:12] SPEED TURN AROUND
[17:36:16] AHHH B, turn around! Oh my god...
[17:36:19] Is it over?
[17:36:20] I think its over.
[17:36:23] Hold on though. hold on though hold on let me tell here's the thing let me tell um
[17:36:31] let me tell let me tell my team team real quick chat about...
[17:36:56] Let me tell my team about it. Hold on, chat.
[17:37:18] Hold on, chat. Call Kevin.
[17:37:20] He's back.
[17:37:21] Is he?
[17:37:24] No, he's not.
[17:37:25] Oh no!
[17:37:44] Oh no! Hold on! I'm not. No, he's not.
[17:37:51] What the fuck do I do? Alright, so we gotta go to the game.
[17:37:56] Hold on chat, we gotta go to the game. I'm gonna text him, hold on chat we gotta go to the game i'm gonna take some i'm gonna text him hold on
[17:38:05] oh I hope you good, bro.
[17:38:27] I think his phone died i think it's phone dot hold on i need the bathroom chat hold on
[17:38:53] check out he's a bad one Check out these about one hour. okay Yeah, yeah, yeah, yeah Let's go! In the club with my homies
[17:38:55] Tryna get a little V.I
[17:38:57] Down in the low keys
[17:38:59] But you know I'm real
[17:39:02] I said it, she was turnin' it for me
[17:39:04] From the game she was steppin', and while you were back, but she knew me
[17:39:08] I decided to cheat
[17:39:10] But my face, she got heavy
[17:39:13] She had me stirrin' like she's ready to blow.
[17:39:17] Oh, oh, oh.
[17:39:20] She said come get me.
[17:39:22] So I got up and followed her to the floor
[17:39:26] She said, baby let's go
[17:39:28] When I told her I said
[17:39:30] Yeah! Yeah!
[17:39:31] She got drunk
[17:39:32] Said come here and see
[17:39:34] Yeah! Yeah! I can't stop
[17:39:37] I got you all ready
[17:39:41] You be my girl, baby
[17:39:43] That's the party
[17:39:49] I'm a bossy streamer Yeah! Next thing I knew, the robber was screaming Yeah!
[17:39:53] Yeah!
[17:40:08] She's on her way to have time yeah We never gonna keep the feel down Cause I'm the 110, she's a 7520
[17:40:12] But that shit say me
[17:40:15] Cause I don't know if I take that chance
[17:40:18] She swear to take it for an elite But what I lose I do, oh Take a chance She's frantic on me
[17:40:20] But what I lose
[17:40:21] Oh
[17:40:22] The way she dance
[17:40:23] Makes Shawty all right for me
[17:40:24] The way she dance
[17:40:26] Oh
[17:40:26] I'm like yeah
[17:40:27] Just put that out for me
[17:40:29] She asked for one more dance And I'm like, yeah, just put that out for me. She asked for one more dance and I'm like, yeah.
[17:40:32] How the hell am I supposed to leave?
[17:40:34] And I said, yeah.
[17:40:36] Should've got down, said, probably yes, please.
[17:40:39] Yeah!
[17:40:41] Who's that fucking so proud of you that you want me
[17:40:43] Yeah, hey
[17:40:45] You're my girl, gonna be the best thing on the scene
[17:40:47] Yeah
[17:40:49] The next thing I do is all up on the streaming Yeah, yeah, yeah I got you in the ball
[17:40:52] I'm screaming
[17:40:53] Yeah, yeah, yeah
[17:40:55] Yeah, yeah, yeah
[17:40:57] Yeah, yeah, yeah
[17:40:59] Yeah
[17:41:00] Hey, hey
[17:41:01] We on that Watch out for my outfit It's ridiculous yeah Head steady, I'ma melt the cows Get up out the gang, I'm a spit the truth
[17:41:13] I won't stop till I get them in they birthday suits
[17:41:15] So give me your rhythm and it'll be off when they close
[17:41:17] Then bend over to the front
[17:41:19] And touch ya toes I left the track. things on my kids in my shit right he's not oh shit pause Pause!
[17:41:47] Pause.
[17:41:49] I check! Is it time?
[17:41:52] Ted, is it time?
[17:41:55] Oh my god. okay So first things first
[17:41:57] Chat
[17:42:00] First things first
[17:42:02] What do we need? He's arrested
[17:42:04] I just text him I just text him. Just text him.
[17:42:06] I just text him. Chat, first things first is what?
[17:42:10] Rebuild right? We gotta rebuild right? New build? new build
[17:42:23] he is back
[17:42:24] yes What are y'all talking about? Is he good?
[17:42:34] I hear something
[17:42:36] Oh, slipstream said one sec?
[17:42:38] Let me make sure they're good.
[17:42:39] Hold on, hold on.
[17:42:40] Make sure they're good.
[17:42:41] Hold on, hold on, hold on.
[17:42:41] Make sure they're good.
[17:42:42] Make sure they're good, chat.
[17:42:44] Make sure they're good.
[17:42:46] I don't give a fuck.
[17:42:47] Hold on.
[17:42:49] Wait!
[17:42:53] Open doors?
[17:42:57] Hot damn. Wait!
[17:43:06] Wait!. Wait! Bro, it's over bro. It's over my nigga!
[17:43:41] Speed got arrested just now not how you know.
[17:43:43] Live from jail?
[17:43:45] What?! Who do you mean, live from jail?... Okay, Chad we might just...
[17:44:42] Yeah.
[17:44:43] I ain't gonna lie.
[17:44:44] We-we-we yeah, yeah, yeah, yeah.
[17:44:46] Aight! Yo, slips! Slips! I said slips. Oh my god
[17:44:48] yo
[17:44:52] Yo what the fuck?
[17:44:56] Slip sweet? Let me see.
[17:45:02] Slips... let's see.
[17:45:05] What'd he say?
[17:45:11] One sec, we are stuck in being told no filming. They tried to shut camera off but I refuse. Few minutes till we leave refuse few minute to relieve.
[17:45:22] Oh, shit.
[17:45:24] Yo! Yo-yo-yo!
[17:45:26] Ah, Sonny! Sonny!
[17:45:28] New build! Sonny, new build. Sunny, new build.
[17:45:30] Sunny.
[17:45:31] We need a LeVar, right?
[17:45:33] Yo, chat, we need the final
[17:45:35] build.
[17:45:39] Do you want a new... Yeah, I think I should make a new...
[17:45:40] Do you think I should get a new weapon chat?
[17:45:48] I don't think so, bro. I think I just need to just
[17:45:51] Well, I don't think I need one. I think I just
[17:45:54] Yes what weapon?
[17:45:59] Bro what weapon?
[17:46:06] Oh my heart rate's not even on.
[17:46:09] They didn't put it on me.
[17:46:13] Hold on a second let me put my heart rate on real quick
[17:46:25] a hammer A hammer? Yeah, I think I should be using a cocka.
[17:46:28] Fuck you mean cocka nigga!
[17:46:30] Nigga you cocka!
[17:46:32] Cocka you, nigga.
[17:47:08] Fuckin' talk about some cockle. Is it working? Oh, here we go.
[17:47:27] Come on, come on, lock in! I'm gonna lock him. Why would I do that? Why would I do that?
[17:47:28] Why would I do that? What the fuck? so so so Bro this damage is ass! The damage on my shit is ass bro! It's ASS! I'm not sure if this is the best way to do it, but I think you can get a lot of points for that.
[17:48:47] I don't know what's going on here... Yo! It's Agh! Yo, yo, yo, yo, YO!
[17:48:51] Oh wait, wait hold on.
[17:48:52] Are you in the traffic?
[17:48:53] I'm not.
[17:48:54] I'm just trying to get out of here.
[17:48:55] I'm going to go back up there and then we'll see what happens. NO! NO! Oh wait, wait hold on.
[17:49:02] Sonny you got fragments?
[17:49:06] Wait sonny you got fragments?!
[17:49:14] I have everything.
[17:49:23] Where? Where? Okay, hold on. Hold on.
[17:49:24] Hold on.
[17:49:25] Hold on.
[17:49:26] Hold on.
[17:49:27] Hold on.
[17:49:28] Hold on.
[17:49:29] Hold on.
[17:49:30] Hold on.
[17:49:31] Hold on.
[17:49:32] Hold on.
[17:49:33] Hold on. Let's, hold on. Hold on.
[17:49:34] OK, let's rebirth real quick.
[17:49:37] Let's rebirth first.
[17:49:38] Show me the first Le'Var shit to get.
[17:49:43] Let's get back to the strongest build chat. The one that we had, the one that we had chat what's the- it was a fire build that we had right? That was hitting for 3k right?
[17:49:52] Chat there was a build that ticket for $3,000 right?
[17:49:58] I don't have one.
[17:50:00] I don't think so.
[17:50:02] I think I only got 1 last thing.. Shit, you gotta um...
[17:50:22] Get the sword.
[17:50:34] Look, I don't have it!
[17:50:38] Is it that way? Look, I don't have it. Oh.
[17:50:41] See? I need it! Where's the first one at? Send it to my... send it to my shit.
[17:50:45] I bet Dio's got you, got you, got you, got you. Hold on.
[17:51:11] I'm with Dios right now. i bet you got you got your gosh Wait, they got the Levar shit in the DLC map? map what
[17:51:22] what because the larvartins in the DLC map chat?
[17:51:26] I did not know that.
[17:51:35] Laval, whatever the fuck you- however the fuck... How do you even say it? Wait, hold on a second.
[17:51:36] Oh my gosh!
[17:51:38] Oh my gosh!
[17:52:27] Oh my gosh. Hello, hello, hello. hold on so No, no, no. Pastor Grace... Past the greats...
[17:52:36] Past the greats of nighttime.
[17:52:44] ... Who beat the DLC? That's crazy.
[17:52:58] I heard Moist be the two bro he's free
[17:53:09] ludwig beat it he's free x beat it he's free that's crazy face Face way, he is free! yes w w w sunny w sunnich w sunny W Sonny.
[17:53:54] Is it thy way?
[17:53:58] Ah, chat! OK.
[17:53:59] Yo, what's the bet have before come on everybody cook
[17:54:02] anybody cook everybody cook everybody cook anybody cook start cooking we'll
[17:54:06] build it out before that was hidden for 3,000 it was 60 Bador.
[17:54:14] Right? Then it was what? I think wait
[17:54:27] Chat hold on let me see this real quick
[17:54:30] Wasn't the one
[17:54:34] Wait hold on did Did they have 41 Endurance? Was it this one?
[17:54:36] Was it the one that had Arcane at 60?
[17:54:40] And Dexterity at 37?
[17:54:44] It was that same one?
[17:54:52] 41 so i'm on
[17:55:03] 37 37
[17:55:09] 60. I'm a lot speed after like when he clip it and shit
[17:55:13] what is this shit is clipped so i can't i
[17:55:15] can't i gotta focus i gotta focus i got a mission i got a mission
[17:55:18] i actually have to me i have a mission bro i have a mission
[17:55:24] 18.
[17:55:27] I have a mission, bro.
[17:55:38] What am I missing?
[17:55:38] Oh.
[17:55:40] I got an extra.
[17:55:42] Next 30.
[17:55:51] 60, 21, 41, 18, 38, 98, 60.
[17:55:56] Dub Junior with the five-git depreciated! Chat I cannot I can appreciate it.
[17:55:59] Chat,
[17:56:00] I cannot... Listen guys,
[17:56:01] what's going on Speed Gang?
[17:56:02] What the fuck is up
[17:56:03] Speed Gang?
[17:56:05] Yo Speed Gang
[17:56:05] what the fuck is up?
[17:56:06] Look,
[17:56:08] I gotta...
[17:56:09] I actually have to think.
[17:56:11] Look, I actually have to focus up, bro.
[17:56:13] I cannot waste any more time on Elden Ring, bro.
[17:56:15] Like, deadass. I'm so sorry, bro.
[17:56:19] Like, I'm actually dead ass right now i have to lock in bro um all right
[17:56:23] what's next first frag first frag okay
[17:56:28] give us some frag.
[17:56:34] Just clip it! Just clip the video! There's mega videos I can watch later.
[17:56:42] First frag... First Frank.
[17:56:51] Where's this at? Awwwwwww. Where is that at, that shit zoomed in as a motherfucker. Wait, is everything purple?
[17:57:07] Everything purple is the frags?! So that's the grace point. And... Go up.
[17:57:27] Go up this one right here.
[17:57:31] Chat, everybody spam locked in chat!
[17:57:32] Everybody spam locked in!
[17:57:59] Everybody spam lock the fuck in!'s been locked the in everybody's You have to follow the exact like safety line right i gotta follow like i was doing that. I started off here.
[17:58:10] All right, back up.
[17:58:20] Oh! Should I be down or up?
[17:58:28] Should I be down or up? Should I be down or up? Probably down, right?
[17:58:32] Should we be down or up?
[17:58:36] Should we be down or up? AHHHHHH I'm sorry.
[17:58:46] My nigga! My nigga... Monega!
[17:58:49] Monega.
[17:58:51] Monega.
[17:58:54] Monega. Monega. My nigga.
[17:59:02] The fuck, bro?
[17:59:09] Nah, I'm really about to do a festival, bro. I ain't gonna lie, I'm locked. I'm actually locked.
[17:59:11] 2024 or 2025?
[17:59:19] How am I going to get out of here? I might have to say that it was a 2025 project.
[17:59:26] I think it was 2024 though.
[17:59:30] But I would have to just promote like 3 months or 6 months in advance
[17:59:39] How long did they promote? Like 6 months?
[17:59:42] Oh shit. Wait what?!
[17:59:50] Wait a minute maybe not
[17:59:55] probably like 3 months I don't know so Oh my gosh.
[18:00:25] Yo, which way is it? Fuck!
[18:00:29] Go right through the rocks here. Like over here?
[18:01:05] Oh shit. here so Where the fuck is it? To the left and cave on the right.
[18:01:19] This way? Let's go, let's go.
[18:01:24] Let's go sonny let's go sunny Do I have to keep going that way what is this so okay so that you got that one check out one off the list, check that one off the list. Make sure we mine that, we don't need that, we don't need that.
[18:02:37] I have to go back out? So...
[18:02:41] Wait do I go like this set?
[18:02:45] Oh Morph place.
[18:02:47] Morph place, Morph place...
[18:02:50] Morph Place, where's Morph? Where's Morph?
[18:02:54] Where's Morth? Where's Morth face? Middle of the map.
[18:03:05] Where's Morph? I'm right
[18:03:13] Wait but that arrow points to...
[18:03:16] That's why we're still going to the same place.
[18:03:20] Because that arrow looks like there is two.
[18:03:24] No? looks like there's two you know
[18:03:30] it says
[18:03:33] this one right here. Is this where I'm going?
[18:03:42] Wait, but you said Morph. Morph is all the way over here!
[18:03:46] Well Sonny... There's two in the first photo that you sent me. Unless there was just one that I needed.
[18:03:55] Did I get the other one? Okay, look.
[18:04:12] More space...
[18:04:17] Ok
[18:04:23] I gotta go down. I have to go down this way and go You can go...
[18:04:31] to the first floor, and then
[18:04:36] five. 5
[18:04:47] Chat like a fucking chat
[18:04:52] Like the fuck it ya Fuck this whole chat nigga after y'all is all trying to make me like your happy monday you are today's monday right so I'm not sure if you can see the First off, I think...
[18:05:30] Wait, what chat?
[18:05:34] Why it's not go in? so What the fuck?
[18:06:08] Bro, what is this game?! this one so I see, I see a cross.
[18:06:49] TAP! W's, W's, W's, W'S!
[18:06:55] Oh fuck...
[18:06:58] What? What?
[18:07:00] What?
[18:07:02] What?
[18:07:06] What?
[18:07:13] What? Is that one? Is that the one I needed or is there another one down here?
[18:07:18] Or is it more?
[18:07:21] Hold on, is that more? Hold on, that boy Sonny is 2 for 2 right now.
[18:07:24] The mods are 2 for 2!
[18:07:56] Oh shit... Hi. What else? Is there another one? Is that another one?
[18:08:14] Am I late now or we just started? also What would that be?
[18:08:22] What would that be? You don't have it.
[18:08:25] How did I get there?
[18:08:33] Bro, what do you want me to do?
[18:08:34] Okay, bro.
[18:08:36] Oh my gosh bro
[18:08:38] Jay I know I gotta play Elder Ring right? Oh shit.
[18:08:47] Wait, oh fuck!
[18:08:49] Wait, is he okay?
[18:08:50] Oh shit!
[18:08:53] Wait! wait
[18:09:18] it's still bad. Yo!
[18:09:34] Yo, what the fuck? That's fucking fucked bro.
[18:09:36] They let that happen.
[18:09:38] They should have let us leave right away Yeah, let's go. Let's go. Drive up.
[18:09:50] We're gonna do some getaway driving.
[18:09:52] Be careful. Be safe.
[18:09:54] I will.
[18:09:56] Emmanuel can I have my
[18:09:58] uh... bike back please? Oh god, got the light gone. manuel can i buy a black bag please come on like oh bro they stole that mic
[18:10:05] gee
[18:10:10] yeah but like bro before i knew it was just off bro
[18:10:17] you can't keep losing these lights Mike's probably... All right, I'll wait. Come on the way.
[18:10:23] Is this the last one you got?
[18:10:25] I have another set but it's in Germany.
[18:10:31] You know where we're going to go? Oh my god! I don't know what was over here.
[18:10:33] Oh, my God.
[18:10:35] I didn't want to see this driver.
[18:10:41] Yeah... Everybody okay?
[18:10:45] What? I'm saying we just got a little tip.
[18:10:49] Well, what happened?
[18:10:52] It's for like everything. You know what I'm saying? We need the main motorway, bro. What's going on?
[18:11:07] Yo, this is Moroccan bro!
[18:11:09] You okay? Yeah we're good.
[18:11:11] I thought I wasn't getting in the car bro.
[18:11:14] He's good ch chat he's good
[18:11:17] Chat he's good
[18:11:18] Chat he's good
[18:11:23] W safety
[18:11:25] W safety, W safety. W safety, W safety.
[18:11:28] Boom! Yo bro...
[18:11:30] Holy shit that shit look-
[18:11:32] That shit look crazy. crazy Hold on, chat.
[18:11:56] Thousands of criminals! What?! hold on chat thought criminals what
[18:12:02] that said thug criminals
[18:12:08] w dogs W thugs
[18:12:09] Yo
[18:12:13] Yo Thugger Yo, thug af fans.
[18:12:23] Sometimes I get a little thuggish.
[18:12:25] Sometimes I get a little thuggy set
[18:12:38] so time to get a little thuggish chat.
[18:12:41] The hot towel of his shirt!
[18:12:48] Alright, bud.
[18:12:50] Okay bro. Like... all right but okay like bro like what the fuck
[18:12:57] how do y'all think of this shit I can we lock in bro all this time that i've been wasting
[18:13:04] we're gonna regret it later you understand me all this time
[18:13:08] that we are wasting we're going to regret it later now we know he's okay
[18:13:15] we man you
[18:13:20] and you nigga fuck you bitch man fuck you
[18:13:31] y'all gonna be laughing at me.
[18:13:33] That's the shit that we...
[18:13:34] You don't even know,
[18:13:35] we in the same boat, gang.
[18:13:37] You know that?
[18:13:38] We in the same boat.
[18:13:39] No cap.
[18:13:40] We in the same fucking boat.
[18:13:43] Fuck is you talking about my
[18:13:44] nigga it's that i'm the one that's driving the
[18:13:47] boat
[18:13:49] i'm driving the boat bro pause all right where do I go Pause. Alright, we're done though!
[18:13:58] Hold on...
[18:13:59] Look at that DMs, look at that DMs.
[18:14:04] It's... it's not busy looking up.
[18:14:06] I'm gonna build it to left and go down.
[18:14:08] What should i move?
[18:14:18] Okay, here we go Here we go
[18:14:20] Here we go chat
[18:14:21] Here we go
[18:14:22] 67 hours is fucking crazy bro
[18:14:25] Like
[18:14:26] Bro like What the fuck is going
[18:14:28] on?
[18:14:36] Say do I need to go touch grass, my nigga?
[18:14:41] Should I be going...
[18:14:44] This is not it.
[18:14:45] This is not the, this isn't the right one
[18:14:50] this ain't the right one huh?
[18:14:53] aww shit
[18:14:56] sonny this ain not the right one, huh?
[18:15:07] How do I get to Grace? Or are you gonna just work on that?
[18:15:12] How do I get the grace?
[18:15:14] Alright, back to that.
[18:15:16] Alright, back to that.
[18:15:18] Alright, send me the next one. Some of the next ones. I'm going to try and get the I don't own.
[18:15:56] Okay, you're going from here and you're rotating down.
[18:15:58] Okay back.
[18:16:00] What's the best animal in the world?
[18:16:17] Tell ya, I know that Green Sharks can live up to 400 years Is it down?
[18:16:39] Sonny, is it down? Fight two hippos?
[18:16:44] What do you mean fight two hippos?
[18:18:15] GG's Gigi's. I'm going to go back and check. chat you're easily chat so so I'm not sure if you can see the so so Fire! Fire!
[18:18:30] Let's go! The next one is across, right? so so Who the fuck is this? so Oh
[18:19:47] No, let's go! LET'S GO BOY!
[18:19:50] LET'S FUCKING GO!
[18:19:52] Let's go sonny, next!
[18:19:54] I'm not going to let you get away with this.
[18:19:57] I'll be right back. Let's go!
[18:20:14] Where am I going?
[18:20:25] That zoomed in like a motherfucker. What the fuck is going on? Damn!
[18:20:33] Is it top left?
[18:20:42] Why did I have this area unlocked?
[18:20:46] Is it this one? It has to be this one.
[18:20:49] Is it this one
[18:20:57] chat that was in the chat y'all i'm using a chat
[18:21:04] but these fries like help me like at a good extent
[18:21:10] these guys they gotta out be right it should be i should be better than what the fuck I am right now, huh?
[18:21:21] What purple...
[18:21:25] I don't know where purple is. Oh, I don't know what purple is oh i don't know where purple is
[18:21:40] that's gonna be bad Tell me where to go. Go slowly sounding.
[18:21:56] You are falling in small measures.
[18:22:18] That right there? Okay.
[18:22:19] South!
[18:24:30] Keep going south and down. Thank you for watching! so uh I'm going to have to do this again. Come on, bitch. so so so so Let's go! Now what? W chat, w chat, w-w-w chat.
[18:24:34] Oh yeah where's the map at?
[18:24:36] I should be able to get it
[18:24:49] How do i get this fucking map? I think I can sub-bottom.
[18:24:50] I can't jump down there.
[18:25:52] The map is down, chat. so so from where you are at I'm setting up another frag over there. How do I get in there? Aiden Rose is lost?
[18:25:54] Is Aiden Rose lost yet?
[18:25:58] Is he? He's real.
[18:26:07] It is good!
[18:26:09] I think it is good bro It's good. I think it's good bro,
[18:26:12] it's good to like
[18:26:14] you know chill
[18:26:18] It's all about how you come back, that's it.
[18:26:26] Yo, where did I go, chat?
[18:26:28] Fuck!
[18:26:31] I'm here. I'm here.
[18:26:37] Sonny, where should I go?
[18:26:39] I'm here. Sonny! Yeah! Yo!
[18:26:56] Yo!
[18:27:13] YO! Bro, shut up. No!
[18:27:23] Wait, why don't you just tell me where to go? You might as well get this out the way now.
[18:27:24] Oh, are you gonna look it up? All right, all right, all right. Might as well get this out the way now Rot rotate up there.
[18:27:38] Okay, back. middle of the field over this there I'm going to go in this room. Is it this rat? Oh.
[18:28:27] It is that rat! Oh... I'm going to have to stop that. Come on, here.
[18:28:47] Just this tree. tree oh no Oh no!
[18:29:10] I'm forward? oh Come on, come on, come on! so Oh my gosh!
[18:30:05] Oh my gosh!
[18:30:07] OH MY GOSH!
[18:30:11] Ah, where's that- where is it at now?
[18:30:28] **Loud, heavy music** You don't want to get Max my nigga!
[18:30:34] Right chat we should get Max?
[18:30:38] Or should we go now?
[18:30:55] I was trying to get.
[18:30:58] Like, what's wrong?
[18:31:04] Alright find out exactly where to go from
[18:31:06] and find out how I'll get that map
[18:31:08] Find out how I'll get that map from or whatever how I'll get map, ugh. How the hell I get that map from or whatever
[18:31:10] how I get there for real and then
[18:31:16] Alright man and then at the front of like
[18:31:20] Then Imma go Spun out, like... And I'ma go.
[18:31:23] Set us up the plan?
[18:31:54] I wanted to get maxed bro. um I used them yes i used them my chat yes Okay, FIRE ON THE DORONAS! Okay
[18:32:25] That was a good run
[18:32:26] Fuck
[18:32:28] That was a good one
[18:32:31] That was a good one
[18:32:33] That was a good one bro That was a good one that was a good one bro
[18:32:36] that was a good run oh my god i'm not gonna get another good one
[18:32:40] oh my god so so so so so Fuck! Come on bro, come on come on so we're gonna get that bro we need those so so so so so I'm not sure if this is the best way to end it, but I think that's a good idea.
[18:35:22] I don't know what to do it, but I think you can just go with what's in your inventory.
[18:35:32] I don't know why they're doing that here... so so so so so I'm not sure if you can see it, but the Fuck. Okay.
[18:36:41] Okay, okay! Come on, come on!
[18:36:44] Come on, Jack, come on!
[18:36:46] It's alright, it's alright, it's alright...
[18:36:48] Fuck me, fuck!
[18:36:50] Fuck! Come on. man
[18:37:55] come on that was a good one that was gonna run that was a good one that was a good one so so I'm lucky. so Fuck! Why am I not double, why can't I double roll?
[18:37:59] Why can't I double roll?
[18:39:48] Why can't I double fucking roll, bro. so so I'm going to try and get the so so Fuck me! Fuck me! Fuck me! Oh my god.. Fuck!
[18:39:50] I don't want to text.
[18:39:51] I'm takes my teammates uh so so so I'm not sure if you can see it, but the so so Triple. so I'm not sure if this is the best way to do it, but I think it's a good idea.
[18:41:56] I don't know what to say about that. so so I promise you, bitch!
[18:42:40] Oh my gosh!
[18:42:46] Dig.
[18:42:48] No more heals, no nothing. That's a good run though, that's a good one.
[18:42:52] That's a good run, that's a good run, that's a good one that's a good one that's a good one
[18:43:27] it's not a bad one better than yesterday, bro. so I'm not sure if this is the best way to do it, but I think that's a good idea.
[18:43:52] I don't know what to say about this one... Whoa, after a massive fire attack like that he should not be able to turn around!
[18:43:56] He should not be able to turn the fuck around!
[18:44:35] FUUUCK! FUCK! so so Come on, bro.
[18:44:36] Come on, bro.
[18:44:38] Come on, come on, come on, come on,
[18:44:39] come on, come on lot once i get these other
[18:44:42] frags i can see how to already see the difference bro i've already seen
[18:44:44] different that ass i thought that's going to be so I'm not sure if you can see the Jesus Christ! so Well, I should be doing phase one effortlessly bro literally oh my god!
[18:46:19] Bro, they're gonna nerf him bro.
[18:46:22] They're gonna nerf him.
[18:46:24] Chat, they're gonna nerf him.
[18:46:26] Bro, they're gonna nerf him bro. They're gonna nerf this n***a bro.
[18:46:34] They're going to bro! that uh so so so so so so I'm not sure if you can see the so so so so so so I'm not sure if you can see the so so What?! Bro.
[18:50:07] Boy this nigga doesn't give no breathing room bro!
[18:50:12] NONE! And I can't fucking see!
[18:50:17] I can't. Fucking. See. uh so so so Lord, in the message of Jesus, I saw to me a big story.
[18:51:13] I am lucky to know you. me uh so so so so so so so so so so so so so so so so I'm going to have to do this again. I got some hits bro.
[18:54:41] We're getting to phase two a lot easier now.
[18:54:43] We're getting to phase two a lot easier now. now. so Hold on. Try locking. uh so so Fuck! Fuck, fuck, fuck!
[18:56:14] Fuck! fuck so so so so so so so so I'm not sure if you can see the so so so so oh That's my bat, that's my bat.
[18:59:11] Hey! We get a base too! A lot better!
[18:59:18] I ain't gonna lie bro.
[18:59:20] This is progress my nigga.
[19:02:07] Hold on bro... Cut on, bro. What the hush? so I'm going to try and get the gun. so so so so so I'm not sure if you can see the so so so so I'm not sure if this is the right way to go.
[19:02:31] I don't think so, either. Oh! I'm not sure if you can see the Use the face-to!
[19:02:35] Use the face-to! Help! HELP!
[19:02:43] Bad fucking run, bro.
[19:02:46] Like you just know when it's a bad- When there gonna be a bad run, bro.
[19:02:48] Fuck! Fucking run. Like you just know when it's a bad, When there's gonna be a bad run bro.
[19:02:49] Fuck!
[19:03:13] You just fucking know, bro. I'm gonna go to the other side.
[19:03:17] Yeah, I need more people.
[19:03:22] Yo! Remind me? yo remind me rune phase two bro i'm not gonna look at the chat but so so I'm not sure if this is the best way to do it, but I'll try.
[19:03:59] I think that's a good idea. so so Oh my god, come on bro.
[19:04:42] Oh my goodness man!
[19:04:52] Come on bro i'm too greedy man
[19:06:28] boy i didn't dodge like my dodges are not what it's I'm going to have to do this again. so I'm not sure if you can see the so so so oh Bro! Oh my goodness man, what the fuck. Goodness gracious.
[19:06:39] Sonny let me know where you got them frags boy.
[19:06:41] My fault I didn't mean... I meant to say boy! Frags boy Deep water's perfect. I'm not sure if this is the best way to do it, but I think you can just go with what's in your inventory.
[19:07:11] I don't know why they're doing that here... so so so so so so so so so so I'm not sure if you can see it, but the Fuck! so I'm not in phase 2 long enough to see what the fuck happens.
[19:09:41] I think I've seen all the moves but bro i didn't get used to it I'm not going to let and get the right angle. so so Oh my god, how do you like...
[19:10:40] How do you escape that?
[19:10:44] How do you escape that?
[19:10:49] Wow. How do you escape that? Oh my gosh. so so so I got that! I dodged that!
[19:11:42] I fucking dodged that shit, man.
[19:11:44] I fucking dodged it bro
[19:11:46] I fucking dodged it my nigga
[19:11:48] I fucking dodged it bro
[19:11:50] Yo what the fuck What the fuck I fucking dodged it, my nigga. I fucking dodged it, bro.
[19:11:54] Yo, what the fuck, man?
[19:14:34] Fuck! so so so so so so so Oh my god! so so so uh so I'm not sure if you can see the background noise. I don't know. I don't know. I don't know. I don't know. I don't know. I don't know. I don't know. I don't know. I don't know. I don't know. I don't know. I don't know. I don't know. I don't know. I don't know. I don't know. I don't know. I don't know. I don't know. I don't know. I don't know. to do it, but I think that's a good idea.
[19:15:00] I don't know what you're talking about, but I'll try my best to get through this one. so I'm dodging too, my timing is off.
[19:15:07] My timing is just off bro, my timing is just off bro, my timing is just off for my timing is this all of bro my tummy it's so off my tummy is so off though
[19:15:12] my tummies is awful my timing is off bro so I'm not sure if you can see the Oh, my God. so uh so so so so so I'm not sure if you can see the Thank you. so so Let's go, let's go, let's go, let's go. so so so I'm not sure if this is the best way to do it, but I think you can just go with what's in your hand.
[19:18:55] I don't know why they're doing that here... so Give me a chance!
[19:19:14] Give me a fucking chance!
[19:19:16] Give me a fucking chance!
[19:19:19] Hey, hey bitch!
[19:19:21] Stop telling me the fucking name you fuckin'
[19:19:23] Pussy ass bitch. I was about to
[19:19:25] Fuck out you in GTA nigga. Stop telling
[19:19:27] Me the fucking name yo bitch ass nigga
[19:19:29] Who the fuck you think you're talking to, nigga?
[19:19:34] You can't see a nigga trying to fucking hit me?!
[19:19:36] Are you not understanding what the fuck is going on my nigga?!
[19:19:40] Huh?!
[19:19:41] ARE YOU NOT FUCKING UNDERSTANDING IT?! Oh my god! Are you not fucking understanding it? so so so so so I'm gonna off myself in GTA bro. so uh so so Oh, shit! Yo, yo, yo, send them frags over to the DM's bro.
[19:21:54] Send them frags over to the DM's my nigga.
[19:21:57] Before I fucking spaz out on this bitch,
[19:21:59] I'll break this whole set of these motherfuck bitch. I'll break this whole set in this motherfucker,
[19:22:01] I don't give no fucks nigga!
[19:22:03] Fuck you talking about 4k train?
[19:22:05] Who gonna fucking die today bitch?
[19:22:07] Fuck you talking about yeah bitch?
[19:22:09] Pussy pussy ass bitch? Fuck you talking about, nigga? so so so so so so so I'm not sure if this is the best way to do it, but I think you can get a lot of points for that.
[19:23:43] This is where we're going to have to go, Steve Harvey you a fuckin' bitch ass nigga.
[19:23:53] I hate your fuckin board head and your fuckin mustache.
[19:23:56] What the fuck you doing, Game Strong?
[19:23:58] I fucking hate this-
[19:24:02] Bitch, I'm fucking trying to get this thing off!
[19:24:04] Oh my fucking god!
[19:24:06] Oh my God man. Oh my fucking god! Oh my god, man. Oh my fucking god, bro.... so.. so Oh my god, I can't take this shit no more bro.
[19:25:47] Sonny send the fax to DMZ already bro.
[19:25:50] Send it to DMS bro. so What the fuck is going on in my life, bro? Bro!
[19:26:21] This is the last thing in my way. Do you understand me?
[19:26:25] There's not one more boss, there's two more main bosses...
[19:26:28] this is the last thing.
[19:26:36] This is the last thing, bro.
[19:26:39] I'm going go get those frags real quick so.. so so Wait, hold on. well
[19:27:59] was is mode so I I got that, bro. so so so so so so so That was a good one.
[19:30:08] That was literally
[19:30:08] a beautiful one.
[19:30:11] That was literally a beautiful run! That was literally a beautiful fucking run.
[19:30:15] That was an amazing run, but guess what?
[19:30:19] What are amazing runs when the fucking gamers ass.
[19:30:24] Sometimes you just have great ones, but you as a gamer your ass!
[19:30:30] So you got to understand bro. Don't get fucking hype nigga. Be humble. Sit
[19:30:36] the fuck down. I'm so ass that the only reason I beat this motherfucker is because it's like
[19:30:54] eventually, my nigga, you're gonna have a good
[19:30:56] run. It's not like oh he scaled
[19:30:58] and he's getting better. No! It's just
[19:31:00] EVENTUALLY this niggas gonna have
[19:31:02] a good run So I'm not sure if you can see the so I'm not sure if you can see the I'm going to have to do this faster. here
[19:32:12] slowly but surely chat slowly but slowly bro
[19:32:13] just believe bro just believe my so I believe.
[19:32:33] I believe, bro. i believe so so so I'm not sure if this is the best way to do it, but I think you can get a lot of points for that.
[19:33:30] I don't know what's going on here... so so so I'm going to try and get the Oh my gosh, bro.
[19:34:25] Like fuck man.
[19:34:29] Fuck!
[19:34:31] Yeah let me get the frags bro.
[19:34:34] Let me get the frags real quick.
[19:35:25] Is it the one that you shot already?.. I Gotta rotate up
[19:35:35] Mr.. Fragat Where's the frag at?
[19:35:45] Is it here? the fuck
[19:35:59] yo is it here? Mark the map.
[19:36:01] Nigga, this...
[19:36:10] How do you get there though? Oh.
[19:36:23] Wait, I gotta go straight? Or do I gotta go four and three?
[19:36:29] Four...three... I'm not sure if you can see this, but the game is actually
[19:36:37] running on a single screen.
[19:36:42] So it's kind of like a Is there a wind? Is it up or down bro? so so why is this game so hard bro I'm going to go ahead and do that. so so What the fuck is going on?
[19:38:27] Do I gotta beat them? so Only you had fire. Bitch!
[19:38:56] ... so chat what the fuck?
[19:39:19] did i not follow it? so Bro, am I going inside this cave or no bro? Yes, my nigga.
[19:39:59] There is no other pathway.
[19:40:44] Nigga, look! Fuck! No way it's this hard, bro. Bro. Boy, the map is wrong. This is wrong.
[19:40:49] The arrow is higher.
[19:40:54] The arrow was supposed to be higher than that, yeah the arrow...
[19:40:56] What the fuck sonny?
[19:40:58] The arrow's way higher than that.
[19:41:02] I mean it's low. way higher I'm is low Thank you for watching! I'm not sure if you can see it, but the so so Here we go!
[19:42:11] GG's.
[19:42:14] GG's. ggs I'm not sure if this is the right way to go, but it's a good idea.
[19:42:34] I don't know what that means, but I think we're getting there. W map!
[19:42:54] Finally bro. finally bro Okay.
[19:44:16] Okay. Is it up top. so I'm stuck. Upstairs. Upstairs! upstairs so Oh, what the fuck?
[19:45:02] Oh my gosh, bro All my fucking oh my gosh I am south. Ain't no fucking doorway right here bro now find doorway in rooms what are you oh am i like am i like
[19:45:55] like what Nigga, what?
[19:46:10] Upstairs not a hole?
[19:46:17] This doesn't even make sense. sense
[19:46:45] where is the doorway I swear to fucking god, my nigga. I'm gonna throw this shit straight through my mind right now.
[19:46:56] Like really? This is the dumbest?
[19:46:58] This is the dumbest?
[19:47:00] I'M ON THE STA- so so so so I
[19:47:57] Got niggas fucking stupid, my nigga?
[19:47:59] Like I'm convinced like we literally-
[19:48:02] Like are we all just fucking dumb?!
[19:48:05] Bro! Instructions are fundamental, my nigga.
[19:48:11] Where the FUCK?! Fundamental Monica where the fuck Where left right
[19:48:20] Left Left! Where? Left, right
[19:48:24] straight.
[19:48:28] Right Right! Nowhere! Straight! Nowhere! straight now we're
[19:48:49] oh y'all likes'all trolling me bro. Along the wall, along the wall of the building.
[19:49:08] Along the wall there's a small hole. You have to look at the
[19:49:10] wall because the hole is small, it ain't big
[19:49:13] enough so get off your horse and just walk. so so so okay fine
[19:50:01] next one why did that take so fucking long?
[19:50:12] Next one. next one Next one. Holy shit chat what the fuck bro this game is so like oh my, this game is like. I can't read all that.
[19:51:28] Type it in the DM...
[19:51:29] Oh, fuck.
[19:51:30] I don't know.
[19:51:32] Hold on. Hold on. type it in the DM... ah fuck I don't know hold on
[19:51:34] cat out to the left go through right through door
[19:51:36] cat out to the left
[19:51:38] go through
[19:52:57] ... Left, go to the right. so so so so so Wait, what's that? Is that it? I don't know.
[19:52:59] It was a little bit of a surprise for me to see you here.
[19:53:03] I'm sorry.
[19:53:20] I didn't mean to hurt you. Wait, what's that? Is that it?! so
[19:53:53] who's the lever I was back left, right side. This is also the back...
[19:55:24] Okay okay so oh my gosh so so so so That shit is not funny, bro Shit is not funny though
[19:55:50] it's not funny monica I'm not sure if you can see it, but the so
[19:55:57] next Next!
[19:56:01] NEXT!
[19:56:04] Let's fucking go chat.
[19:56:30] Next, next, next. I got three of these. Ooh, I got three!
[19:56:36] Wait so I gotta question... Sunny how much more do I have left?
[19:56:43] Okay, minus the boss...
[19:56:45] Minus that side-boss one.
[19:56:47] How much more am I able to get?
[19:56:49] Bro, we need to get all...
[19:56:50] We need to get all... but we need to get all.
[19:56:51] I'm telling you bro.
[19:56:52] You got three now so how much do I have left?
[19:56:59] So three...
[19:57:01] No no no no! go three
[19:57:11] no no get no no see you told us we enough nigga I need the frags bro chat back to now chat we need that let's just get that out the way bro let's
[19:57:17] just get let's just get that off the way gang Where the next one's at?
[19:57:33] I don't wanna just keep leaving this shit.
[19:57:35] I want to like be at...
[19:57:37] The Dom, bruh.
[19:57:42] Wait! It's nine more including the sideboards or nine more without the sideboard?
[19:57:47] Well that sideboard don't have none right? Okay, back.
[19:58:00] So Sonny what's the word?
[19:58:04] Do we just not have it yet or what?
[19:58:20] Alright then. Does anybody in the chat want to say something like where to go?
[19:58:40] Anybody in the chat? No. Up where? Top left top left oh they chatting bro
[19:58:43] they don't know where huh
[19:58:45] they don't know where huh
[19:58:52] up here here here
[19:59:15] i don't know bro
[19:59:19] here Here?
[19:59:28] Who's that at?
[19:59:31] Recluses River upstream gates.
[19:59:33] Where is it at?
[19:59:34] Where is recluse this?
[19:59:36] Middle right of the map, its river.
[19:59:38] Middle right. middle right
[19:59:49] see you see how like jay i see that right i see how good my conscious clues are
[19:59:53] you see You see?
[20:00:03] Where am I at now?
[20:00:14] Kai you're very cute and handsome. Oh shit thank you bro.
[20:00:22] Not bro I mean girl. Girl, I'm sorry. Oh thank you.
[20:00:31] I think we might have... You sure we didn't get this one? We might have got this one, I don't know.
[20:00:38] Now we did it!
[20:00:49] Oh no! Is my heart rate...
[20:00:52] Wait a second.
[20:00:57] Is it working? Sonny, get the instructions.
[20:01:05] ... This way?
[20:01:34] Uncle left.
[20:01:44] Not here?
[20:01:48] No, I'm going to hug right. so Is that it? Fuck. What the fuck?
[20:02:33] Keep going down!
[20:02:39] What the fuck? what the I don't want to leave any cook. Oh fuck. so Wait, I went down too fast?
[20:03:41] What? Bro, why did I just I'm going to try and get him. Okay, bro. Where did I go, bro? Here?
[20:04:22] Here? I can go where? All right. so Oh my gosh, bro!
[20:05:16] Where do I go?
[20:05:17] Where do I go?
[20:05:18] Where do I go?
[20:05:19] Where do I go?
[20:05:20] Where where where where where where where where where. Oh my gosh. uh I don't even know where we are. so so Come on!
[20:06:25] Where the fuck did i go so so so right
[20:07:45] right now we're so Fucking hell, y'all.
[20:07:54] I... OHHHH! No!
[20:09:21] Now where? Oh, there's two more in this place? What time is it, chat?. Yo, where'd I go?. The boat full of grace and glory. Charge on the top right of map. Okay...
[20:09:26] Oh yeah, I keep forgetting it's summertime chat.
[20:09:30] It's close to east.
[20:09:33] Close to East.
[20:09:37] What do you mean close to each?
[20:09:42] So this way.
[20:09:45] Tell me when to stop.
[20:09:48] Tell me when to stop! Two on the stop.
[20:09:55] Is it down here? here Here? so I'm gonna go in and get the That bitch ass nigga aint drop shit. I'm gonna go to the uh...
[20:11:42] the I'm kids. Two kids, yeah five.
[20:12:12] No no no.
[20:12:16] What?
[20:12:17] Hey you got my shit, nigga?
[20:12:24] Nigga have my shit.
[20:12:27] Nigga have my shit chat!
[20:12:34] Next next next next next go fast. Go fast. Go fast ten kids need a PC what the fuck
[20:12:42] What you mean tank kids need a PC?
[20:12:47] Next. Yo, I can't wait to binge watch Harry Potter bro!
[20:12:51] Harry Potter gonna be so- I need to binge watch Harry Potter bro. Like, it's just so...
[20:13:00] Where?
[20:13:01] We're moving fast as fuck, let's go.
[20:13:39] What the hell is that?. so Don't worry, we're giving away four PCs so your kids might just buy...
[20:13:40] Them 10 kids might just win one.
[20:13:44] Hold on, what's the next one? Oh, I'm making a pick Them 10 kids might just win one.
[20:13:44] Hold on, where the next one?
[20:13:46] I'm making a pick.
[20:13:49] This one is a far run.
[20:13:51] All right, Beck, come on let's do it.
[20:13:57] Is that right? Let's just fucking do it.
[20:13:58] Let's get this shit over with, alright?
[20:14:01] Let's just get this shit the fuck over with bro. move it around. Okay, another photo. Hold on. Hold on.
[20:14:28] But we keep dying chat!
[20:14:30] It's bad.
[20:14:36] Castlefront... Castlefront all the way to
[20:14:42] Castlefront
[20:14:49] Did he go to sleep yet? No.
[20:14:51] Chat, we didn't get to sleep for 69 hours right?
[20:14:53] We didn't- He didn't go to sleep for 69 hours
[20:14:55] Fuck them
[20:14:57] Nah Sonny would've been up And that... Nah, Sonny really been up.
[20:15:00] And that boy Sonny did not get no sleep, bruh.
[20:15:08] Oh I had the grace.
[20:15:13] Oh, I can't grace.
[20:15:22] Should I go to it? And then, where's the rune at?
[20:15:27] Oh, it's the one right there. Is it the one that is highlighted?
[20:15:41] I have a good... No, where where is it where's it
[20:15:48] where's the Rizzi
[20:15:51] it's in the cave.
[20:15:59] What's up, man?
[20:16:01] My nigga David!
[20:16:04] Oh my god what the fuck happened? What the fuck happened?
[20:16:06] What the FUCK?!
[20:16:08] I just happened- what's wrong?
[20:16:10] Nah it's a chest fucked up and its all concrete
[20:16:12] Hold on chat hold on chat hold on chat, hold on chat. Alright name it then, motherfucker.
[20:16:14] Hold on chat. Bro you finally hit the fucking house!
[20:16:16] What's going on?
[20:16:18] This is crazy bro. I know right this thing looks good.
[20:16:20] It's crazy yo what the fuck.
[20:16:22] Hey everyone listen to our release song One of one. Oh shit. Hey, I know what they're doing. They're on a lease song!
[20:16:24] One of one!
[20:16:25] Oh shit.
[20:16:26] One of one.
[20:16:27] That's not good bro.
[20:16:28] It was good bro.
[20:16:29] You better open your eyes.
[20:16:30] I know but I want my game and shit right now.
[20:16:32] Now you really are gaming bro.
[20:16:33] Who is the better getting real agent?
[20:16:35] 100%. The last one?
[20:16:36] 100%, 100%
[20:16:37] I think you're top 3 in angina
[20:16:40] Wait what do mean now?
[20:16:41] I've been top three before this
[20:16:43] After the first out of everyone
[20:16:44] I've been top three
[20:16:46] Alright so where are you?
[20:16:50] Davis, be honest!
[20:16:54] Alright, me Phantom Me.
[20:16:57] Phantom.
[20:17:02] The only person that's really ass is Chris.
[20:17:06] No, did you see what he did? He's like cheatinghe's cheating in his game. Why? What is he doing?
[20:17:07] Bro, he's actually using magic and shit bro!
[20:17:10] Yo, Duke is using fucking magic bruh!
[20:17:13] This shit is crazy but this looks fucking good.
[20:17:15] I know this shit looks fuc-
[20:17:16] I know bruh. I fucking love it. Can I spin this shit was- I know bruh.
[20:17:20] Yes sir, ski!
[20:17:22] Yo get the skishots in chat! Skishot this nigga
[20:17:26] It's a smoke machine. Hold it down.
[20:17:30] Yo, what the fuck?!
[20:17:34] Way this!
[20:17:36] I'm proud of you man.
[20:17:37] How much longer you got in there, man?
[20:17:38] I'm on the last boss!
[20:17:40] You got this my lady.
[20:17:42] It is hard!
[20:17:44] But it's hard as fuck!
[20:17:48] Look at my death counter.
[20:17:53] You been doing this for 70 hours?
[20:17:56] Bro, I wanna go outside so fucking bad bro! Bro, when you get done bro we gonna set up a nice party thing bro.
[20:17:59] Party?
[20:18:00] Yeah like just on the outside so you can enjoy yourself.
[20:18:02] Alright man, see ya in the morning.
[20:18:04] You gon bring the hose?
[20:18:06] Nah nah nah I'm good.
[20:18:08] You wanna do it?
[20:18:10] Yeah yeah hit the hole to me! No't do that. I can't do that.
[20:18:12] Yo this crazy!
[20:18:14] Aight bro!
[20:18:16] Oh my gosh bruh.
[20:18:18] Yeah wait we just gonna fuck up.
[20:18:20] We're going to get him.
[20:18:24] We got him. We got him. Oh my god, yeah wavies in a fucking chat Don't be means me W man's, man.
[20:18:36] W man's.
[20:18:37] W BBL, man.. Alright, let me see if I can see something real quick.
[20:19:06] Come on chat!
[20:19:13] Where do we go now?
[20:19:22] Hold left until you fall down, then turn 180 and fall forward. I gotta go back out
[20:19:32] wait why am i stop hold, why am I sound go?
[20:19:51] Okay, hold left. Put that instruction again. Hold left until what?
[20:19:56] Hold left until you fall down then turn 180 and run forward
[20:20:01] hold up until you fall down the turn 180 and one four Still in hall.
[20:20:24] Wait, did I turn 180 or was that... No, that was definitely 180. Left 4 right!
[20:20:28] Left 4 right, left or right, left or right? Left or right, RIGHT?!
[20:20:36] Oh my fucking gosh.
[20:21:04] ... Oh, shit. oh my god my dumb ass bro
[20:21:32] all right let's look let's get to this. Watch it.
[20:21:33] This is crazy, bro.
[20:22:19] What the fuck? Here? Here? wow this is crazy bro what the here so Fuck. Got trolling bro trolls bro
[20:22:29] can we beat him though.
[20:22:36] Wait... I'll check the end. Follow exactly. Where the fuck am I?
[20:22:51] Oh, damn!
[20:22:53] Oh, damn!
[20:22:55] So we're gonna go to this place and then
[20:22:57] we'll be back in a minute. We're going to get out of here oh oh damn oh damn so we're gonna do
[20:23:03] one two three damn four Damn, four.
[20:23:14] Five.
[20:23:18] Six. Seven. Six?
[20:23:29] Yo chat, what the fuck? Oh that shit is confusing on my map.
[20:23:40] I got that grace, right? down GG. I'm not sure if you can see it, but the What the fuck?
[20:24:53] Big ass! so What the f- WHAT THE FUCK?! Dashie?
[20:25:34] What happened to Dashie? I'm having to dash you.
[20:25:45] Study this way? That's supposed to me.
[20:25:58] Oh, what?
[20:26:01] You're lying bro
[20:26:03] R.I.G.? Oh, I G
[20:26:15] Bro you're lying You Wait, what? Oh yeah.
[20:26:37] Over that dragon bay. But what? Oh! Oh my gosh!
[20:26:58] Dashie!
[20:27:10] Welcome back to Super Mario. There, Dashie! Superb! Yo.
[20:27:16] Damn, Dashie!
[20:27:18] You ain't gonna do that to Dashie!
[20:27:22] YOOOOOO!!!
[20:27:26] DASHIE!! Dashie!
[20:27:34] Dashie! Ow. There's a lot of guns out there.
[20:27:40] There's a lot of guns out there.
[20:27:43] Raiden!
[20:27:45] You really gonna leave it like that right now? Yo, I'm not leaving this place. No, sweetie. Raiden!
[20:27:48] You really gonna leave it like that right now?
[20:27:51] Yoooooo!
[20:27:55] Yo this shit is a full circle moment bruh
[20:28:00] this is a full circle moment
[20:28:09] do we got motion?
[20:28:17] The red, red like bro what Bro, what?
[20:28:45] Fucking Dashie?!. Yo, man.
[20:28:48] Bro, what?
[20:28:52] Yo, that's fucking crazy as fuck. What the fuck?
[20:28:54] Over the dragon...
[20:28:55] Yo, that's actually insane bro!
[20:28:59] W-ing the fucking champ bro!
[20:29:04] Bro, that's crazy
[20:29:08] God damn
[20:29:14] Get about say you definitely want to dash you bro Yeah, Devontae you done put me onto Dashie bro. Now my older brother did a- wait was it Devont? No.
[20:29:17] Yo that's crazy!
[20:29:19] Devontae put me on to Dashie, my older brother
[20:29:21] and then my younger brother put me on to Corey Kenshin.
[20:29:29] Overweight? Hold on. Over and waiting in front of you to the right.
[20:29:59] This is a very dangerous situation. to the right. so Over here?
[20:30:31] Over here?
[20:30:39] Around rock to left. Come on guys!
[20:32:07] Straight. Go this way? And what, a hug left? so I'm going to go up the red areas I gotta take a shit. I don't know where.
[20:32:36] Hold on, let me look at that map, I gotta look at that map hold on. so This way, this way, this way! Which way? Bratzel doesn't take it there.
[20:32:38] Which way is he going to go?
[20:32:40] Oh, I see him.
[20:32:42] He's not here yet.
[20:32:44] He's just waiting for me to come back. I'm gonna have to get out of here this way this way this way which way pretzel doesn't take it there which way I'm up!
[20:33:02] The marker's over here! so so so
[20:33:48] with another tank thank you so much brother.
[20:33:51] Fight this rhino? So yeah, it's him right? Fuck. so so The Three more! Let's keep going.
[20:35:16] Let's keep going, bro.
[20:35:22] Let's keep going chat.
[20:35:24] Oh fuck. chat oh fuck
[20:35:28] that's not a map below the time our settlement now this nigga Sonny's
[20:35:33] cooking Chad W fucking funny, there's something that...
[20:35:43] Where is it at? Now. Where's that? uh
[20:35:59] where's that
[20:36:03] left Was it a call?
[20:36:13] All of my friends are dead, leave them in the cold and put them in a tundra. door to left uplift
[20:36:35] fuck Fuck.
[20:36:43] Fuck!
[20:38:36] Y'all gotta go around? I'm going to have to do this again. You motherfucker! This way! so Oh, I had a grace. Keep going up. We have to go I'm assuming that just keeps going up. I don't know where to go! I'm not sure if you can see the so Straight.
[20:39:27] And... so so What? What?!
[20:39:55] What?!
[20:40:01] Nigga, what? I'm not sure if this is the best way to do it, but I think you can just go with what you have.
[20:40:26] You don't need to be too careful here.
[20:40:31] I'll try and get a few more of those. yo I'm gonna get mad.
[20:40:49] What the fuck! so so I'm going to have to do this again. Yo bro, these creatures in this fucking game is insane.
[20:41:34] What the fuck? so yes next yes Let's go!
[20:42:05] Let's go chat!
[20:42:16] W is in the fucking chat, let's go! Oh! What's next?
[20:42:20] Blue Castle up top,house first floor base.
[20:42:28] Blue castle up top, storehouse first floor base. Let's go chat.
[20:42:47] 70 hours this is why we gotta get this shit over with he has to die bro there's
[20:43:01] a huge statue hanging.
[20:43:06] You jump at his feet.
[20:45:13] Where? This?! so I'm gonna go back to the so I gotta go up one more, bro. I don't know. so Oh, what? so so Oh, where do I go, manega?
[20:45:50] I see the statue but how the fuck did i get up there so Bro, are you fucking dumb?
[20:45:51] Are you fucking dumb?
[20:45:52] Are you dumb? Are you dumb? dumb so so But what?
[20:46:32] I'm gonna get pissed.
[20:46:33] How you going blind?
[20:46:41] What? What the fuck?
[20:46:51] How do you go up? Well, I did not see this.
[20:46:58] Well, I'm not even supposed to be on the first floor then.
[20:47:01] Well, I'm not as many people to be in the first floor there's no way. so so so. And I might as well. It is never my foot. Oh my god so For these NPCs? npcs so so I'm not supposed to be on the first...
[20:49:23] Bro, I think it was...
[20:49:24] No.
[20:49:25] I think we'll do like a fourth floor.
[20:49:26] Okay?
[20:49:35] Right, chat? No? ggs GG's
[20:50:03] Bro, I look dumb. I look so dumb chat
[20:50:06] I look dumb as fuck
[20:50:09] FUUUCK Fuck! so so
[20:50:42] ggs GG's! so so Oh my fucking god!
[20:51:28] I can't open up my map! so Heal right?
[20:51:54] Heal right? Heal right?
[20:51:58] Shut the fuck up
[20:52:02] Wait how am I healing
[20:52:10] Six floor Sixth floor.
[20:52:14] Seventh floor.
[20:52:18] Okay, he said there's a level on the sixth floor that I gotta pull.
[20:52:23] It's 11, right?
[20:52:27] Please! Oh shit... Please?
[20:52:31] Oh, shit. so Am I good?
[20:53:08] Where's that, where is it at?
[20:53:25] Where's that? Go back. I was over there.
[20:53:30] Wait, what?
[20:53:48] The fuck? Yo, where do I have to go?
[20:53:58] Do I have to go down one.
[20:54:20] Here? so Yo, where do I go bro? Left.
[20:54:21] Oh my god we got to get out of here. Oh, I bet.
[20:54:32] Where now?. Alex! Oh yeah. What frag level are you and how many do you have?
[20:55:13] What frag level are you?
[20:55:21] I'm at like, chat what am I at? Like 18.
[20:55:25] 18. I'm at 18 with the frags that I have
[20:55:29] I'm at 18.
[20:55:36] I might just have to go, Che.
[20:55:39] Che, I might just have to go bro.
[20:55:41] Oh my gosh.
[20:55:50] Oh my gosh.. I think i'm good now Oh I'm good. You still don't think I'm good?
[20:56:54] Let me try.
[20:57:02] 90 Autumn Holes! uh so I'm going to get you. Bad run! Bad run, bad run, bad run. That was a bad one.
[20:57:42] That was a bad one, that was a bad run.
[20:57:47] Bad run, that one.
[20:57:52] I'll back him. so ah so I'm not sure if you can see the so so so I'm not sure if you can see the so so so so so I'm not sure if you can see the The so Fuck! Fuck!
[21:01:02] Had a bad one, not a bad one
[21:01:04] Not a bad one at all
[21:01:06] Not a bad one
[21:01:10] Not a bad one at all. I need to pop the rule, no?
[21:03:02] I keep forgetting. so I'm not sure if you can see the so so so so so Fuck.
[21:03:05] FUCK! Fuck... Fuck! Oh my god this nigga K, bro. so so so Come on!
[21:07:08] Come on! I'm on up! so so so so so so so so so so so so so so My sword, my sword, my sword!
[21:07:10] My sword was not out.
[21:07:12] My sword was not OUT!
[21:07:17] MY SWORD WAS NOT OUT!!! FUCK MY SWORD! out my sword was not out
[21:07:26] there's definitely progress though bro there's definitely progress though bro. There's definitely progress, bro.
[21:07:28] From yesterday? Oh my fucking god
[21:07:30] from yesterday
[21:07:32] what the fuck
[21:09:25] BOOM fuck so so so so so so so so I'm not sure if you can see the Fuck. Fuck!
[21:09:28] Fuck!
[21:09:31] Fuck!
[21:09:33] Well if he keeps spamming those sword swings it'll be better bro.
[21:09:36] If he does the sword swings with that combo and I'll
[21:09:44] in the back one about bomb what
[21:09:52] up so so so so so so I'm not sure if you can see the That was my fault.
[21:11:14] That was dumb, that was dumb, that was dumb.
[21:11:18] That was actually dumb, that was actually dumb. That was dumb. That was so dumb.
[21:11:22] That was so dumb.
[21:11:30] That was so dumb. uh so so so so I'm not sure if this is the best way to do it, but I think you can just go with what's in your inventory.
[21:12:42] I don't know why they're doing that here. so Oh Ah Oh my gosh!
[21:13:11] Fuck!
[21:13:14] Progress, progress, progress progress progress progress progress progress It literally comes down to timing, chat.
[21:13:36] That's what wins you the game.
[21:13:37] It's your timing.
[21:13:38] That's what literally wins to the game it's your timing
[21:13:39] that's what literally wins you the
[21:13:47] game so so I'm not sure if this is the best way to do it, but I think you can get a lot of points for that.
[21:14:18] This is where we're going to have to go through some more so so so I'm not sure if you can see the so so Oh my god.
[21:15:34] Okay, so the light rolls?
[21:15:37] The light rolls are the best rolls.
[21:15:40] I can evade quicker like out of panic
[21:15:44] I could actually evade like not quicker but further it makes you roll like
[21:15:50] further
[21:15:53] like
[21:15:56] you feel me?
[21:18:07] Oh. uh so so What? so so so I'm not sure if you can see the so Fuck! Fuck, fuck, fuck, fuck. Light roll is definitely me right?
[21:18:10] Defense wise?
[21:18:12] Light roll is definitely me right?
[21:18:22] Defense wise bro to get up out of here yes it is bro
[21:18:27] out of panic for me as a player bro it is
[21:18:34] it really is i hate the that's not paying attention but like how don't y'all pay attention bro row. Hold on, chat.. I call.
[21:19:38] Get your ass back on that fucking grace so uh I'm not sure if you can see the so I'm going to get you!
[21:20:46] Early roll, early roll, early roll. Early roll! Early roll!
[21:20:48] Early roll, early roll, early roll.
[21:20:50] Come on KC you got this KC come on bro.
[21:20:54] Come on. KC come on bro come on so so Come on!. so so so so so so so so so so so so oh I'm not sure if you can see it, but the so so so so so so so Fuck! Fuck man, fuck. He's not giving me space bro.
[21:25:48] I definitely need mana right? You're not giving me space, bro.
[21:25:57] I definitely need mana right? I definitely need mana
[21:25:59] Like...
[21:26:00] I definitely need that right? The two?
[21:26:02] I definitely need the two
[21:26:04] 100%
[21:26:06] I do though.
[21:26:08] I think I do.
[21:26:20] Only have one. I need that so so I was lagging in my head!
[21:27:00] I lied, I lied!
[21:27:02] I LAGGED!!! so. Come on, Casey. Come on, KC.
[21:27:42] Come on, KC.
[21:27:45] Come on, KC.
[21:27:50] I don't fall in attic now, bro.
[21:27:51] Sometimes you need to detox, bro detox bro no detox from the game
[21:27:54] bros get your like i gotta see some i go on tick tock i see a bitch motivated so oh The oh so What?
[21:29:04] What? What what what the fuck?
[21:33:01] oh so so so so so so I'm not sure if you can see the so so so so so so so so so uh so so I promise you, a thousand year voyage guided by compassion. compassion Why would I drink my manna?
[21:33:03] Why would I do that?!
[21:33:05] WHY WOULD I DO THAT?!
[21:33:07] How can I let, like...
[21:33:09] How can I go from the back, like...
[21:33:11] How you gonna put in a pack like...
[21:33:18] The only good thing about that is it's not instant death.
[21:33:22] Shout out to the developers for that. That's not instant death. Shout out to the developers for that,
[21:33:23] that's not instant death.
[21:33:25] Thank you.
[21:33:26] Thank you for that.
[21:33:28] Thank you.
[21:33:32] Thank you, bro.
[21:33:48] I'm gonna try to save my mana.
[21:33:52] Yo, I gotta try and save my mana bro!
[21:33:59] I gotta try and save that mana until phase 2 bro. I gotta try and save that, I'm not going to lie chat.
[21:34:01] We just got to get him down bro.
[21:34:03] We just got to break them down.
[21:34:05] It's the cheese move that little teleport and then how do you dodge the back?
[21:34:10] And then...
[21:34:13] How?! How?
[21:34:25] Bro, you just got a hope that you got.
[21:34:28] Bro, you just got a hope that you got... Well, you just gotta hope that you got...
[21:34:30] Enough health.
[21:35:11] The I'm not sure if you can see the so so I'm not sure if this is the best way to do it, but I think you can just go with what's in your inventory.
[21:35:43] I don't know why they're doing that here... so so I'm not sure if this is the best way to do it, but I think you can get a lot of damage out of that.
[21:36:28] I don't know what's going on here... so so Oh, I lagged bro, I hate when I lag in my head.
[21:36:31] I just start lagging and I fucking don't!
[21:39:17] I just started laggin' bro, in my head bro my brain just like lags bro uh so so so so so I'm not sure if you can see the so I'm not sure if you can see the so so so so so I'm not sure if this is the right way to do it, but I'll try.
[21:39:27] I think that's a good idea. That's not even fear, bro. That's not even fear, bro.
[21:39:30] Like...
[21:39:31] Okay, I'm gonna go to the bathroom and get some water. bro like okay like I understand like ha sparkles everywhere shit but hit sparkle
[21:39:45] like like you got a double roll every one of Hit sparkle like...
[21:39:50] You gotta double roll every one attack.
[21:39:56] And that builds panic rolling bro! You gotta double roll every one attack bro in that so so so so so so so
[21:41:33] you Fuck! Come on bro,. Come on, bro!
[21:42:09] Come on, man... Oh my god, come on chat.
[21:42:19] Yo, when we take a break ever, chat remind me there is a video to react to alright? Alright chat. Yo, there's a video, there's a video. so so so so so so I'm not sure if you can see the so so so I'm not sure if you can see the so Oh my GAAAAAAAASH!
[21:44:46] What the fuck?!
[21:44:47] WHAT THE FUUUCK?! so so so so so so Oh my fucking gosh.
[21:46:13] What the fuck is 52, my nigga?
[21:46:19] What the fuck is 52 bro? What the f-
[21:46:33] What the fuck is 52?
[21:46:37] Yo.
[21:46:41] WHAT THE FUCK IS 50 FUCKING What the fuck is 50 fucking 2?
[21:46:47] Oh, 52 to 100. 800. so so so so Oh, my God. My controller is like my fucking controller is not
[21:48:04] God damn fucking working. It's not it's not working it's not registering enough it's like it's not
[21:48:12] it's not is that my fucking wi-fi box my nigga is that wife, why the fuck? They don't got no guns in this fucking game?
[21:48:39] They don't have a Glock 30 I can put...
[21:48:42] A fuckin' H-
[21:48:43] A Cal 50 nigga?
[21:48:45] They don't got a.50 cal on this motherfucker, they don't got a DSR-50 or MSMC nigga?
[21:48:49] They don't got no motherfuckin rifle that go fucking with fmj
[21:48:52] bullet on it like a fucking put between his fucking eyebrows they don't got shit ah so so so I'm not sure if you can see the Oh my god. oh my gosh chat lot of mercy chat louder mercy chat oh uh so weird So weird.
[21:50:55] I'm not going to let you get away with this. so so I'm not sure if you can see the so I swear to God, I'm dodging.
[21:51:59] I'm dodging bro!
[21:52:00] I swear to God, I'm fucking dodging, bro. so so. so. I promise you, I'm dodging bro.
[21:53:21] I'm dodging bro, like real nigga shit. Oh my god. but that shit is not dodging. Oh, it's not.
[21:54:15] I'm clicking that bitch bro.
[21:55:29] Fuck!.... so This is where it should get personal, bro. This is where it should get personal.
[21:55:32] When a character in a video game is not allowing me to enjoy my life, this is where shit get personal bro and this is where shit get bad.
[21:55:43] You're not allowing me to thrive you're not allowing me to go outside.
[21:55:47] You're not allowing me to go outside. You're not allowing me to do that.
[21:55:53] This is where it gets personal,
[21:55:54] It's not just a game.
[21:55:56] Who the fuck said this was a game?
[21:55:57] Yo, ban that fucking dumbass! Ban
[21:55:59] that dumb ass nigga who just fucking said that! Are you fucking dumb?! Who the fuck
[21:56:03] raised you, dumb bitch?! What the fuck is wrong with you?
[21:56:09] It's just a game. Are you fucking dumb?!
[21:56:12] Your life is a fucking game, bitch!
[21:56:15] Fuck wrong with you nigga!
[21:56:16] You think I'm standing here and fucking give myself all them 51 deaths?
[21:56:20] 71 fucking hours of my fucking life on this shit!
[21:56:23] And a fucking game?!
[21:56:25] This shit real-life.
[21:56:33] This shit real life bro.
[21:56:41] This shit is real life.
[21:56:45] It gets like that, bro. It gets like that. so so I'm not sure if this is the best way to do it, but I think you can just go with what's in your inventory.
[21:57:19] I don't know why they're doing that here... so I guess, I guess.
[21:57:47] I mean, I guess.
[21:57:52] I guess, I guess.
[21:59:31] I guess bro guess bro i guess so I'm not sure if you can see the so so so so I'm not sure if you can see it, but the so Hehehehe. I'm going home! Oh shit, oh shit, a lot this shit!
[21:59:57] I fucking love this shit right here. so so so so so so I guess, I guess, I guess, I guess.
[22:01:19] I fucking guess!
[22:01:20] I GUESS!
[22:01:21] I just guuuuesssss!
[22:01:22] I GUESS!
[22:01:23] I GUESS!
[22:01:24] I GUESS!
[22:01:25] I GUESS!
[22:01:26] I GUESS!
[22:01:27] You know what? I haven't gotten below his head help on phase two yet
[22:01:32] I'm coming to bleed on face too. Yes
[22:02:14] Oh Yes! so Oh my fucking god bro. Oh my gosh, my nigga.
[22:02:16] Oh my fucking gosh!
[22:02:18] What the fuck? I don't need a good run, bro. so so so so so I'm not sure if you can see the so so Oh my gosh, Lord.
[22:04:21] Lord God.
[22:04:24] I'm just...
[22:04:25] It's not nothing with my build.
[22:04:27] Are you dumb?
[22:04:33] Are you paying attention, my nigga? I'm just you are you dumb. Are you paying attention my nigga? I'm just missing my dodges one of it
[22:04:39] The guy I'm missing my fucking dodges.
[22:04:42] That's what it is literally!
[22:04:44] My dumb ass, I'm just dumb!
[22:07:30] Missing all my fucking dodges one nigga. I'm going to try and get the gun. so so so so so so I'm not sure if you can see the so so so so so so He rises his swords up.
[22:07:31] How do you dodge that? Are you supposed to spam it, my nigga?
[22:07:34] I know what the fuck he was supposed to do
[22:07:37] I KNOW WHAT I WAS SUPPOSED TO DO MY NIGGA
[22:07:40] It's more easier said than done. When you're not praying, when you're not praying it is way easier to see the mistakes when you're watching an NBA game and you see a man opening the three line.
[22:08:06] Okay?
[22:08:06] You see Klay Thompson
[22:08:08] wide open in the three line.
[22:08:11] Okay?
[22:08:13] Then somebody else goes up for the fucking layup.
[22:08:19] And misses.
[22:08:21] You be like, hold on.
[22:08:22] Klay Thompson was wide open.
[22:08:26] You watch film back, you understand now Clay Thompson is not right up on the other side. So now next point
[22:08:31] you go in, you be like okay I got a wide open layup.
[22:08:37] But hold on my nigga Clay is in the mother fucking corner.
[22:08:43] So let me try this strategy out
[22:08:46] so
[22:08:48] you end up passing to Clay Thompson
[22:08:51] and he
[22:08:53] fucking misses
[22:08:54] but then you watch fucking messes!
[22:08:59] But then you watch film back and say, oh
[22:09:01] I should have hit that layup.
[22:09:03] Do you understand
[22:09:05] what's going on? I so so so so so is I'm not sure if this is the best way to do it, but I think you can get a good idea of how much damage you're getting.
[22:10:39] You'll have to wait for the boss to think you can just go with what's in your inventory.
[22:10:50] I don't know why they're doing that here. I'm not sure if this is the best way to do it, but I think you can just go with what's in your inventory.
[22:11:00] I don't know why they're doing that here... so so so so so See? Now you see, right? That's bullshit. What do you call that? Bullshit.
[22:12:10] That's bullshit!
[22:12:14] That's bulls**t!
[22:12:16] Bro, it's like every...
[22:12:19] They made this nigga like...
[22:12:25] How does everything that he does cover the entire map?
[22:12:38] Like... that he does cover the entire map? How does anything that he does cover so I just guessed it up there endos does not work.
[22:13:15] I GUESS!
[22:13:16] I guess.
[22:13:17] I guess.
[22:15:49] Oh! so so so so so so so. Oh my god.. so uh I'm not sure if you can see the What the fuck? What the fuck, what is she doing here? the
[22:15:53] what the well this should be like literally
[22:15:55] like
[22:15:56] this this should be like I need like a ta- I need like a t- I need like a ta-
[22:17:07] I need like a ta- so so I'm not sure if you can see it, but the Panic Rolling! Panic rolling.
[22:17:09] Panic roll! Panic roll! uh so so so so so so I'm not sure if this is the best way to end it, but I think that's a good idea.
[22:18:45] I don't know what else to say about this one...
[22:18:50] ...but I do have some thoughts on how we should go with this game. so so I'm not sure if you can see the so I'm not sure if you can see the so so so oh my gosh bro why is this boss like this?
[22:20:36] Bro, why is his boss like this bro so so I'm not sure if you can see the so so so so so so The the so so so I'm not sure if you can see it, but the so so I'm sorry. so so so so so so so so so so so so so so so so so so so so so I promise you, a thousand year voyage guided by compassion Oh my fucking god.
[22:28:06] This bitch fizzing me up on my drills, man. is basically about my job
[22:28:18] the uh so so so so so I'm not sure if you can see the so I know you watchin' Turn down the fucking difficulty
[22:29:56] Yeah, yeah, yo!
[22:29:58] Death I know you watching this
[22:30:02] Go on my file and turn this difficulty
[22:30:03] Down
[22:30:05] Okay?
[22:30:08] Turn it down!
[22:32:17] Draw my file, and turn this motherfucker down. this down uh so I'm not sure if you can see the so so so so so I need to do an L2 and L1 combo with him actually. I'm gonna do a L2,L1 combo bro.
[22:32:20] I can do a L2,L1 combo bro.
[22:32:23] Oh my gosh
[22:32:27] I'm beating this nigga ass come on, Ima beat you the fuck up come here
[22:36:21] Come here bro so Thanks for watching! I'm not sure if you can see the so so so so so so so so so so I'm a bitch Come here, I'm gonna beat if you can see the so I'm going to have this is the right way to do it, but I'll try.
[22:38:29] I think that's a good idea. so so I'm not sure if you can see the so so I want this nigga dead. i want him dead so so I'm not sure if you can get a lot of damage out of that.
[22:38:50] I don't know what's going on here... I'm not sure if this is the best way to do it, but I think it's a good idea.
[22:39:28] I don't know what that was for. so so I want him dead. I want him dead, I want him dead, I want him dead. so so I'm not sure if you can see the Come on, bro.
[22:40:17] Come on, bro.
[22:40:19] Come on, my nigga.
[22:40:24] Come on, bro. Oh well.
[22:41:14] I'll see you then! uh so so Who the fuck does he think he is, bro?
[22:41:16] Who the fuck does he think he is, my nigga oh god oh my god bro y'all niggas so so so so so so so so so so so so so I'm not sure if this is the best way to end it, but I think that's a good idea.
[22:43:49] I don't know what else to say about this game, but I'll leave it at that for now. so so so so so so so so so so so so so I'm not sure if you can see the so so I'm not sure if you can see the so
[22:47:08] it's like what do you do?
[22:47:12] You feel me?
[22:47:15] It comes up with a realization where you be like yo.
[22:47:19] What do you do in this situation?
[22:47:22] Is this even...
[22:47:23] You start to think like am I even...
[22:47:25] Like is this even a thing?
[22:47:28] Like who the fuck thought it was a good idea
[22:47:36] i can't keep the distance i can't i can't keep distance bro i can't
[22:47:49] but i think every move but i don't know what to
[22:47:52] oh my But I think every move, but I don't know what to...
[22:47:55] Oh my fucking god.
[22:47:57] I'm gonna call the police bro.
[22:48:00] I'm just gonna-I'mma go call the police. I'm gonna call the police bro, I'm going to call the there, bro
[22:48:39] Shit my fear grows up there It's not fair bro, it's not fair bro. It's not fair bro! so. I'm going to go ahead and get the car. It's not fair, bro.
[22:49:19] This shit is firing me to chat.
[22:49:24] The only thing I know it's possible.
[22:49:32] I know it's possible, bro! so so so so I'm not sure if you can see it, but the I need to beat this nigga's ass, bro.
[22:50:55] I need to beat this nigga's ass, bro.
[22:50:57] I need to beat this nigga's ass, boy.
[22:51:49] I need to beat this nigga's ass, bro. I'm going to try and get the gun. so I'm not sure if you can see the Always get caught.
[22:51:52] I always get caught bro.
[22:51:55] I always get caught bro.
[22:51:59] It's the saddest thing is knowing that this shit is possible bro, That's the saddest thing is knowing that this is possible bro that's a satisfying that's the saddest thing so so so so so so so so I'm not sure if you can see the Oh my gosh, bro!.... so so so I'm not sure if this is the best way to do it, but I think you can just go with what's in your inventory.
[22:55:16] I don't know why they're doing that here... so Oh, Yo!
[22:55:44] I'm about to leave a fucking
[22:55:46] Mixer of you on fucking speed.
[22:55:48] I'm bouta-
[22:55:50] I'M BOUTTA AYE! I'M BOUTTA REVIEW- AY!
[22:55:53] I'M BOUTTA LEAVE A FUCKIN' REVIEW ON STEAM, MY NIGGA!
[22:55:56] YOU BETTER LOWER THIS FUCKING DIFFICULTY!
[22:55:59] YOU BETTER LOWER THIS MOTHERFUCKER!
[22:56:02] HEY! Go into my file and lower this please bro.
[22:56:08] I won't say shit.
[22:56:10] Just do it man so so I'm not sure if you can see the so Oh, fuck. ah
[22:57:24] dig deep come on let's go let's go. Let's go, Casey. Come on, bro.
[22:57:33] Nah, this is crazy?
[22:57:35] What, bro? Oh my gosh. My...
[22:58:02] What's inspiring me is Kai'Sa not.
[22:58:06] Okay?
[22:58:08] Oh, shit!
[22:58:16] Valkyrie... Sanat! SANAT!!! My...
[22:58:27] What's inspiring me is Kai'SaNut.
[22:58:31] Okay? Kai'SaNut.
[22:58:33] Okay?
[22:58:35] Kai'SaNut, Kai'Sanat...
[22:58:37] Kai'SaNut
[22:58:39] Um
[22:58:41] I forgot how to play this If he can beat this game anyone can
[22:58:46] The people need me bro. My
[22:58:49] The people need me my niggas the people need me for all the people need me, bro
[22:58:54] The people need me, bro. The people need me, bro. The people need me, bro.
[22:58:55] The people need me, bro.
[22:58:57] The people fucking need me!
[22:59:04] The The people fucking need me!
[22:59:08] They need me!
[22:59:11] Port mostly over.
[22:59:18] THEY NEED ME! They need me! My timeline now?
[22:59:20] Alright, shotgun's done. Let's go out to the Bruins
[22:59:22] I saw that people were clowning Kai and like really blowing it up
[22:59:24] That he died hundreds of times on the tree sentinel.
[22:59:26] People talking about how embarrassing that is
[22:59:28] and all this other shit. See here's the thing what's
[22:59:30] embarrassing is to actually quit the game
[22:59:32] and not beat the game. That's the embarrassing part.
[22:59:34] Giving up is the embarrassing part. He didn't give up that entire time.
[22:59:37] Also, I'd argue that without that fight
[22:59:39] he wouldn't be even half the player that he currently
[22:59:41] is. Doing that fight and conquering
[22:59:43] that is a huge part of player development
[22:59:45] right there. You learn how to actively one hand, two hands,
[22:59:48] when to swing, when not to swing. Could you imagine if he didn't fight that tree sentinel and then
[22:59:52] immediately was like fighting Margit instead? I'm playing some-
[22:59:56] They need me!
[23:00:06] What's inspiring me is high enough.
[23:00:19] I forgot how to play this if If he can beat this game, anyone can!
[23:00:24] My...
[23:00:26] What's inspiring-
[23:00:31] You gotta dig deep, Kai.
[23:00:32] You have to, bro.
[23:00:35] You give the people hope,
[23:00:35] bro.
[23:00:37] That ain't a stray.
[23:00:38] No.
[23:00:51] That's hope I need you. Is he going to give up? Is he going to pay for this? He's not paying me back.
[23:00:52] He's just trying to get my money back.
[23:00:54] You know what, man?
[23:00:55] I'm going to go and get it.
[23:00:56] I don't want to be a burden on your family.
[23:00:58] I'm going to take care of them.
[23:00:59] I'm going to make sure they're happy.
[23:01:00] I'm going to help them.
[23:01:01] I'm going to do everything that I can to keep them from getting hurt. I'm going to make sure they're happy. I'm going to make sure they're happy. People need you, God! They need you!
[23:01:02] Is he gonna give up?
[23:01:04] Is he gonna fucking give up?!
[23:01:07] Are you gonna fucking give up?!
[23:01:10] You let this bitch-ass nigga fuck you up!
[23:01:15] Come on!
[23:01:24] Let's go, let's go, let's go! I'm not taking this shit no more.
[23:01:26] I'M NOT TAKING IT NO MORE BRO
[23:01:28] I REFUSE BRO
[23:01:30] I fucking go
[23:01:33] Yo His palms are sweaty Knees weak Just let it slip Yo, come on
[23:01:34] His palms are sweaty
[23:01:36] Knees weak arms are heavy
[23:01:38] There's vomit on his sweater already
[23:01:40] Mom spaghetti he's nervous
[23:01:42] Been on the surface But he keeps on forgetting Come on! Come on! Everybody's choking now, the clock's run out
[23:01:55] Time's up, over, plow! Snap back to reality
[23:01:58] Oh there goes gravity, oh there goes gravity
[23:02:01] Choke he so mad but he won't give up that
[23:02:04] He know he wont have it he knows His whole batch of these know, he won't have it he knows
[23:02:05] His whole back city is roast, it don't matter his coat
[23:02:07] He knows that but he broke, he so stacked and he knows
[23:02:10] When he goes back to this mobile home
[23:02:12] That's when its back to the lab again yo
[23:02:14] This old rap city bag will capture this moment
[23:02:18] And hope it don't give it a lose
[23:02:19] It's bouncing the music, the moon
[23:02:21] That you own that you better never let go
[23:02:24] You only get one shot
[23:02:25] Do not miss your chance to blow
[23:02:27] Opportunity comes once and a lifetime
[23:02:30] You're at the brink of smelting the music
[23:02:32] The moment you own it
[23:02:33] You better never let it go
[23:02:35] You only get one shot, do not miss your chance to flow
[23:02:37] Opportunity comes once in a lifetime
[23:02:40] Corridor zones escaping
[23:02:42] Through this hole that is taping
[23:02:44] This world is mine for the taking
[23:02:46] Make me king
[23:02:47] As you move toward a New World Order A normal world I'm a man of the mind for the taking, make me king
[23:02:48] As we move toward a new world order
[23:02:50] My normal life is boring
[23:02:52] The super stardom's close to post-mortem
[23:02:54] It only grows harder
[23:02:56] Only grows hotter
[23:02:57] He blows us all over
[23:02:58] His hose is all on him
[23:03:00] Coast to coast shows
[23:03:01] He's known as the Globetrotter
[23:03:02] Lonely roads god only knows
[23:03:04] His own father
[23:03:05] From home he's no farther
[23:03:07] He goes home and barely knows
[23:03:08] His own daughter
[23:03:09] Holds a nose cause here goes The cold water He goes home and barely knows his own daughter
[23:03:09] Holds a nose cause here goes the cold water
[23:03:11] These hoes don't want him no more, he's co-prodder
[23:03:14] They moved on in an X-Move
[23:03:16] Flows deep nosedope and so notter
[23:03:18] His soul is so wild when he's told that I'm close I suppose it's true he knows Take the moment, you own it You better never let it go
[23:03:31] Only get one shot
[23:03:32] Do not miss your chance to flow
[23:03:34] It's like a zoom in your bones
[23:03:36] Once on a lifetime
[23:03:37] You're gonna lose yourself
[23:03:38] In the music
[23:03:39] The moment
[23:03:40] You own it
[23:03:41] You better never let it go
[23:03:42] You only get one shot
[23:03:43] Do not miss your chance to blow
[23:03:45] This opportunity grows once in a lifetime
[23:03:47] Give it up
[23:03:48] No more games of exchange for true core rage
[23:03:50] Tear this motherfuckin' roof off like Rudolph's cage
[23:03:54] I was playin' in the beginning, the mood all changed
[23:03:56] I been chewed up and spit out and boo'd on stage
[23:03:59] But I kept rhymin', step right in the next cipher
[23:04:02] Best believe somebody's payin' a fine type of But I kept rhyming and stepped right in the next cipher
[23:04:03] Best believe somebody's paying to buy a diaper
[23:04:06] All the pain inside amplified by
[23:04:08] The fact that I can't get by with my ninder
[23:04:11] Five, and I can't provide the right type of life for my family
[23:04:14] Cause man these god damn boots stands for white diapers
[23:04:17] And there's no movie that's known to cut fiber
[23:04:20] This is my life, in these times it so hard
[23:04:23] And its getting even harder trying to feed and water my seed is In order to watch for me to understand one spot
[23:04:34] Another damn unknot has gotten me
[23:04:37] To the point I'm like a snail
[23:04:38] I've got to formulate a plot
[23:04:40] Or end up in jail or shot
[23:04:41] Success is my only motherfucking option
[23:04:44] Failure's not Mama love you but this trail has got to go
[23:04:47] I cannot go all in Salem's lot
[23:04:50] So here I go it's my shot
[23:04:51] Be fair man I
[23:04:52] This may be the only opportunity that I got
[23:04:55] You better
[23:04:56] Life is not in the music is Opportunity comes once in a lifetime You better prove yourself
[23:05:08] When the music, the moment you own it
[23:05:10] You better never let go
[23:05:12] If you only get one shot to die
[23:05:14] Miss your chance to blow
[23:05:16] Opportunity comes once in a lifetime You better and so so Outro Music okay It's alright bro.
[23:06:19] Fight again.
[23:06:22] We fight again. We fight again.
[23:06:26] We fight again.
[23:06:35] We fight again. We fight again, bro........ I'm sorry. bro you can't game you gotta understand bro sometimes
[23:08:16] well if i if like nothing gotta think about this though.
[23:08:20] Just like what Rey said right?
[23:08:22] She basically just said...
[23:08:27] I can hit anybody!
[23:08:34] I'm gonna kill everybody! Not with anyone! Right! so Keep going. Oh my god.
[23:09:07] I gotta get locked in, bro.
[23:09:11] That second phase is too hard, bro.
[23:09:15] I gotta see a nigga beat that.
[23:09:16] There's no way a nigga beat that!
[23:09:17] I'm not jacking it.
[23:09:18] I've seen all his moves already but there's no way a nigga beat that, bro. You're a cat!
[23:09:23] You're a cat!
[23:09:25] Nobody's beat that.
[23:09:26] It's all been fake.
[23:09:27] That's fake.
[23:09:28] Everything has been faked.
[23:09:30] Cat!
[23:09:31] I don't...
[23:09:31] I don't...
[23:09:31] I don't think this will work. I don't think this will work.
[23:09:36] X-Gunway 4 AI! so so Oh, they y'all bro. AHHHHH!
[23:10:23] ... so I'm not sure if you can see the so so so so I'm not sure if you can see the so Oh my gosh, come on.
[23:12:27] Come on! Chat this is the last one bro
[23:12:29] chat this is literally...
[23:12:31] This is the last nigga in my way
[23:12:33] Do you know how that feels? I don't think nobody knows how that feels bro
[23:12:39] it's the last nigga in my way so so so so so so so so so so so so I'm going to try and get a better view of the uh so so so so so so so so so I'm going to have to do this again. Two hits.
[23:17:03] Two...
[23:17:05] Two...
[23:17:07] Two Hits?
[23:17:09] Two...
[23:17:14] Two Hits? Two? Two hits?. bro I'm not sure if you can see the so so so Damn it it Chris!
[23:18:38] This shit hard as a bitch, Chris.
[23:18:40] Don't ever get back on my element ring bro.
[23:18:42] I'm scared bro.
[23:18:44] I'm scared.
[23:18:45] I'm playing a horror game now
[23:19:02] I'm literally in the horror game though. shit dead ass scary bro are you feeling what's up like you feel like no phase one i'm mad comfortable yeah face two he's crazy
[23:19:07] i don't know what the i don't know what the fuck... I don't know what the...
[23:19:10] You gotta use magic summons and all types of stuff.
[23:19:12] Bro, you gotta get every nigga on the block to jump that nigga.
[23:19:16] Yes!
[23:19:17] Sacrifice another nigga just to...
[23:19:19] Bro...
[23:19:20] I don't... Bro, phase two is crazy. He's like actually like dead ass, bro
[23:19:28] Well it's not even the purple right now cuz Melania killed me 500 times in less than 24 hours.
[23:19:33] Damn!
[23:19:34] So...
[23:19:35] What's your level?
[23:19:37] Um...
[23:19:38] Huh?
[23:19:41] That's probably like
[23:19:44] 200, 250
[23:19:46] Closing on 300 right
[23:19:48] 250 yeah
[23:19:50] About 250 Millennium beat me 500 wait how much
[23:19:55] other millennial be me chat i might be gassing five probably like four four 418
[23:20:04] 480.
[23:20:06] Probably like 400. Damn!
[23:20:08] All right bro what did you learn from that?
[23:20:09] What did you learn from-
[23:20:10] No but today my progress was all right.
[23:20:11] Yesterday my progress was I better make it to phase 2. Today if you put my phase 2 counter on, if I had a phase 2 counter how many times have I made it there?
[23:20:19] It's way more consistent. So today is just like literally got phase one on down pack.
[23:20:26] But phase two is like...
[23:20:28] Bro, that shit is hard.
[23:20:30] And I gotta be more patient, bro.
[23:20:32] Let me out of here my friends.
[23:20:33] You're getting greedy a lot at a lot of times bro come on bro
[23:20:37] Bro but here's the thing right?
[23:20:38] This nigga is like
[23:20:39] Well they just said fuck it let's give this nigga mad steroids bro
[23:20:43] I'm telling you bro
[23:20:45] I feel like they i feel like they think that's just
[23:20:47] they don't see you know dude i know do you invite
[23:20:50] skype do you know what you could do after this bro
[23:20:53] you go to the movies and then you go get your fucking, go on a spa day
[23:20:57] bro.
[23:21:01] My dumb ass was on a spa day
[23:21:03] the day before this.
[23:21:07] See? He was too relaxed before you got this
[23:21:10] bitch. Bro, come on bro!
[23:21:12] Lock it in bruh!
[23:21:13] You got that shit bruh like dead ass bro
[23:21:15] I be, I'm watching this shit upstairs.
[23:21:18] This is hard bro
[23:21:20] Hey you editing?
[23:21:22] Nah, not the amp piece
[23:21:26] Show this shit Hard drama time I'm trying to show you a hard time.
[23:21:30] What Faye Sweat said?
[23:21:31] Bro, Faye Swagg, bro, that's what he said.
[23:21:33] You beat this shit straight from the first day.
[23:21:36] Me and Ludwig was struggling right?
[23:21:38] I was literally like yes finally somebody's struggling ten minutes later. He beats it last night
[23:21:44] Ten minutes
[23:21:50] I'm just my time is just off bro yeah that's
[23:21:53] funny it you up but my timing is just
[23:21:57] off
[23:22:13] let me try one more time. How do you know that, Leo? It's your build? No it's not!
[23:22:20] It might not be my build bro. I don't think it's my belt.
[23:24:01] Look! I'm going to if you can see the so so so so I'm not sure have to do a little more of this. Why are you attacking him with no energy? Like, you personally.
[23:24:02] Huzzah!
[23:24:03] When you hit him...
[23:24:04] Huzzah!
[23:24:05] Huzzah!
[23:24:06] Huzzah!
[23:24:07] Start hitting him, tagging him like you... I got Huzzah! Huzzah!
[23:24:08] Huzzah!
[23:24:09] Start hitting them, tagging them like you really dissing the elder lord bro.
[23:24:14] Are you the Elder Lord?
[23:24:16] I don't think I hear him because I'm fucking dying to-
[23:24:19] I know, I know. together you see so i don't think i am because i'm dying to know i know i know come on bro you gotta feel it yeah bro that's the
[23:24:24] difference between face swaying I feel like the elder lord. You gotta be the elder lord, bro.
[23:24:29] Oh, bro.
[23:24:32] Hold on let me allocate.
[23:24:42] Now that could slay him. I like Chris, like... Chris, like, I ain't a lot of shit.
[23:24:45] No it's like...
[23:24:46] You know what the pain?
[23:24:48] It's two painful things.
[23:24:50] Knowing this is the last nigga and knowing it's possible.
[23:24:56] Two most painful things bro.
[23:24:59] This niggas not doing anything now. I'm doing real shit right now. This nigga is not doing real life things bro.
[23:25:06] Real life things.
[23:25:10] Huzzah! that Huzzah!
[23:25:32] Huzzah! I'm not sure if this is the best way to do it, but I think you can get a lot of points for that.
[23:25:51] This is where we're going to have you get away with this. I'm not sure if you is the best way to do it, but I think you can just go with what's in your hand.
[23:26:23] I don't know how many times I've played this game and I haven't really noticed any changes. so so yes Let's go! so so so so I'm not sure if you can see it, but the I saw her!
[23:28:09] Chris! I'm sorry, I to do this again. so I'm not sure if this is the best way to do it, but I think it's a good idea.
[23:28:42] I don't know what to say about that one... Huzzah!
[23:28:54] I don't know where the fuck you gotta go!
[23:28:57] That was my best try!
[23:28:59] The huzzahs, I told you.
[23:29:01] The huzzahs this crowd they shit work bro.
[23:29:03] I told ya.
[23:29:05] Hey Elden Ring nigga got to be doing that brother brother. Hazard shit work all the time.
[23:29:07] Hazard, hazard.
[23:29:09] That shit be working, I know.
[23:29:10] But I don't know what the fuck you do against that nigga.
[23:29:12] What the fuck?
[23:29:13] I don't know.
[23:29:14] What the fuck do we believe in?
[23:29:14] Wait, but that was my best try!
[23:29:16] No, I told you the hussar just
[23:29:18] i'm telling you i do this here all the time i wasn't beating the street sitting
[23:29:21] over until i had stands on it yeah like bro when i first
[23:29:26] tried to hit the regular broiggas cocking me up.
[23:29:29] And I said hold on...
[23:29:33] You're fucking with me bro!
[23:29:37] Huzzah! Word bro all right
[23:29:47] and that's a glimpse that's just a a sample of what you could do, bro.
[23:29:50] That's just a sample, bro.
[23:29:51] Finish this nigga, bro.
[23:29:53] Finish this nigga off, bro.
[23:29:54] I don't know how the fuck you beat that nigga, bro.
[23:29:57] That shit...
[23:29:57] That nigga powerful as hell.
[23:29:58] You see his fucking health not moving?
[23:30:00] He is not moving and he's fucking flying doing anime moves bro,
[23:30:03] he's doing anime shit.
[23:30:05] I think he did some shit Sasuke did bro.
[23:30:08] I don't know how-I don't know how he do that shit.
[23:30:11] Somebody just said some shit.
[23:30:13] Somebody just said...
[23:30:16] You doing 823 damage, that's bad!
[23:30:25] Like you're hitting him and he only get 823? Yeah.
[23:30:26] They say 823 is bad.
[23:30:28] Wait so how much damage was niggas...
[23:30:31] Whoa! Nah your character weak i told you your
[23:30:35] character actual build bro i'm not gonna lie hey he just said huzzah works I ain't, I mean...
[23:30:47] I don't know about 823 damage bro.
[23:30:50] I thought you was at least putting 1500 gang.
[23:30:53] Like 823 is crazy bro. That's crazy
[23:30:56] You gotta upgrade your build man
[23:30:58] Niggas is hitting for 2-3 thousand
[23:31:00] Told you bro
[23:31:07] Who do you see hitting for that much?
[23:31:08] There's no way!
[23:31:09] You're lying!
[23:31:10] What?!
[23:31:12] Bro, name a person you've seen hitting for that much.
[23:31:16] XQC. Alright, so
[23:31:18] what's good is I know all his shit now.
[23:31:21] Like, like
[23:31:21] actually how to counter it and shit.
[23:31:24] That's good.
[23:31:25] I'm just satisfied
[23:31:26] of progress, bro.
[23:31:27] I want to beat the nigga? Yes.
[23:31:30] But progress just needs to be shown, bro.
[23:31:35] Chat, hold on.
[23:31:37] Who do you see real quick? Watch Chris go and see this shit
[23:31:43] I was doing 2.5 thousand
[23:31:48] and when I proc bled it,
[23:31:50] It does 8 to 10 thousand
[23:31:57] Swayze it my weapons?!
[23:31:59] It gotta be your weak ass-
[23:32:00] No but he's done New Game Plus though.
[23:32:02] But the fucking bosses will be extra harder!
[23:32:09] Damn... extra harder Damn
[23:32:13] What the fuck is proc bleed?
[23:32:15] You have to be on New Game Plus for that
[23:32:20] You probably got a shark in your knife
[23:32:22] This shit, this shit weak
[23:32:25] This shit weak bro
[23:32:27] Weak ass knife
[23:32:29] Weak a sword.
[23:32:29] Dude, your dude is ass though.
[23:32:30] Can't lie.
[23:32:31] Yeah, it's okay bro.
[23:32:32] I had to use OP shit because he was 30 thousand more health.
[23:32:38] The nigga just called my brother ass.
[23:32:39] Nah, he is. Huh? The nigga just called my build ass.
[23:32:40] Nah, he is.
[23:32:41] Huh?
[23:32:42] Nah, nah, your build weak.
[23:32:46] He's a flex.
[23:32:48] He speak in flex.
[23:32:51] Sway you don't upload Elden Ring content?
[23:32:55] Sway, you don't upload Elden Ring content?!
[23:33:03] Is he crazy? Yeah, let me see it.
[23:33:14] No, we have to review this.
[23:33:15] Chad, clap it up though
[23:33:16] for that best...
[23:33:17] Beautiful fucking shit.
[23:33:21] No, that was actually
[23:33:22] my best run bro
[23:33:23] you've got to feel that what was that 50 without 50 or a little below
[23:33:26] no just below it bro definitely definitely 46 in the 46 range
[23:33:32] pretty pretty decent bro so look i ain't gonna Pretty decent, bro.
[23:33:34] So look I ain't gonna lie if my build is ass imagine where I could be at bro!
[23:33:38] Yeah it's like Fazeway had a playmaking sharpshooter and you had
[23:33:42] a rebounding... I don't know,
[23:33:45] fucking bench player.
[23:33:50] I don't know
[23:33:51] what the nigga did.
[23:33:53] But Faze Wade
[23:33:54] his weapons is better than yours
[23:33:56] the way he plays
[23:33:58] the game, his timing
[23:34:00] is just better. His defense is just
[23:34:02] amazing. Did you even see him
[23:34:04] play? Nah, nah I didn't.
[23:34:06] I didn't see that nigga angle
[23:34:08] What do you mean rebounding
[23:34:10] bench player
[23:34:12] Rebounding
[23:34:14] So this is weird right?
[23:34:17] Ray walked in on somebody I was struggling with like
[23:34:19] Struggling with
[23:34:21] He walks in and said
[23:34:21] Ray stay here see what happens
[23:34:23] I beat him first try
[23:34:25] You walked in
[23:34:26] Best Tried try you walked in best tribe niggas the guys start visiting anymore millennia rage rage yeah
[23:34:39] oh my Rage, yeah. Oh my god it's like the aura is like...
[23:34:41] I don't think I got aura bro!
[23:34:43] Do you be missing us when we're upstairs and shit?
[23:34:46] I don't even think about y'all niggas.
[23:34:50] I'll be locked in my name is not bad but i'm like you know that's how when you walk in that's why y'all walk in i'd be like oh
[23:34:55] like i forgot y'all living thisas living this bitch. Yeah, yeah. Yeah, my brother is.
[23:34:59] So it give me hope that
[23:35:00] oh!
[23:35:01] You feel me?
[23:35:02] But then when y'all leave
[23:35:02] I'll be like
[23:35:03] ah fuck.
[23:35:04] You feel me?
[23:35:05] But bro
[23:35:06] let me see this real quick.
[23:35:08] 330
[23:35:09] 330 last line.
[23:35:10] Sway, why are you not uploading Elderman content?
[23:35:15] Chat, should Sway be uploading Elderman content?
[23:35:38] Okay. Wait! Is Sway still face? face oh hey wait no yes or no they know their dumbest flop faces actually stupid
[23:35:40] for that.
[23:35:42] They're dumb.
[23:35:43] He's not, Jeyz.
[23:35:44] Bro!
[23:35:45] He was FaZe.
[23:35:47] They're dumb.
[23:35:47] They're dumb.
[23:35:48] This nigga Ashley is nice, bro.
[23:35:52] Yo!
[23:35:55] A&P Sway? That's all our own gaming shit, bro. Come on,
[23:35:57] bruh! I mean, it's like good gamers
[23:35:59] in the first place. We can be the A&P main six
[23:36:01] but we need gaming niggas to surround us bro as a community bro
[23:36:06] i have a lot of broke that's actually done well every game that i see this
[23:36:09] thing can hop on he's frying no glaze hold on three hours and 30 minutes get to get the final get
[23:36:17] the final gameplay but like where he beat the nigga bro and finish that
[23:36:20] nigga I dropped him it's stumped him out.
[23:36:25] No, I can't watch it all the way to the end
[23:36:27] because he might spoil it
[23:36:29] there might be some newer shit but...
[23:36:31] Uh...
[23:36:33] I know that um uh yeah no
[23:36:38] You gonna fuck with me? I know What weapon is he at?
[23:36:42] But look at his death count bro
[23:36:44] Wait that's probably Toto Yeah it's probably TOTAL. Yeah it's TOTAL for the DLC nevermind.
[23:37:00] He's on new game 7, he beat the game 7 times right chat? I got hit by the disc
[23:37:04] Chat you beat the game 7 times right?
[23:37:06] You beat the game seven times right?
[23:37:07] You beat the game seven times and make your bosses
[23:37:09] Seven times harder!
[23:37:10] What the fuck?!
[23:37:12] That's what that NG plus 7 shit means?!
[23:37:15] God damn bro!
[23:37:25] Oh no... settings i don't know what i don't know what the fuck is I just saw him.
[23:37:31] He just did pooping!
[23:37:33] You saw that?!
[23:37:35] What the fuck?!
[23:37:37] He sacrificing himself mad times, nigga!
[23:37:40] Look at him!
[23:37:44] What the fuck?
[23:37:47] Oh my god look at this stamina.
[23:37:49] 6,000!!! WHAT?! Oh my god look at his stamina 6000!
[23:37:50] WHAT?
[23:37:52] WHAT?!
[23:37:56] Okay but look, look, look. Notice how on New Game Plus 7
[23:37:58] He gets no breaks he gets no breaks
[23:38:01] he gets no brakes look look he has no break so right like you know what i have
[23:38:05] time to heal yeah i have no time to heal what the
[23:38:09] well no he has no time to heal
[23:38:30] I can't get that weapon huh whoa what yeah that's what it is where are you oh i had no endurance I'm not gonna spoil it, I'm going gonna pause it right before he dies.
[23:38:44] I've seen all his moves bro!
[23:38:46] Bro...
[23:38:51] He just hit a nigga for Nazi's point, hold on I don't know about that.
[23:38:54] He just hit a nigga for Nazi's point. Hold on. Hold on now. Wait, you need to tell the nigga from House of Spoon We'll be out in a minute
[23:39:05] I'm gonna go get him What? Get the fuck out of here. Is he using magic?!
[23:39:09] He's not!
[23:39:11] Oh my god!
[23:39:15] I'm so sorry, dude He's not.
[23:39:17] Oh my goodness!
[23:39:18] I can't watch this shit.
[23:39:19] I can't watch this shit.
[23:39:21] Oh my god.
[23:39:23] Oh my god, bro.
[23:39:26] You've been doing it wrong the whole time, bro. Oh my gosh, bro!
[23:39:28] You gotta start over?
[23:39:32] You got to start over.
[23:39:34] Your build, bro.
[23:39:36] It's a build.
[23:39:37] No, no.
[23:39:37] You can be built.
[23:39:39] Offer?
[23:39:41] What level is he?
[23:39:44] Oh, God damn it.
[23:39:45] Why should I be grinding off... What level is this nigga at?
[23:39:46] He has,
[23:39:47] oh my God,
[23:39:48] he's on,
[23:39:48] oh my God,
[23:39:49] he's maxed.
[23:39:53] Oh my God,
[23:39:54] he's maxed.
[23:40:01] Cause he's on New Game 7.
[23:40:07] WHAT BITCH? What the fuck? What bitch?
[23:40:09] WTF
[23:40:12] Whats up
[23:40:14] Wait where is Kareem
[23:40:17] Where you been at
[23:40:19] Yeah yeah I finished it Yeah, yeah.
[23:40:20] I finished it.
[23:40:22] We did it!
[23:40:24] You didn't see it?
[23:40:28] Oh my gosh.
[23:40:30] He beat it. Say something to the chat. Everybody say in the chat, look I just
[23:40:32] Beat it
[23:40:34] We did
[23:40:38] Bro i did that shit right
[23:40:43] You know what i'm saying bro?
[23:40:47] I didn't beat it
[23:40:52] Yeah you could bro it I didn't beat it
[23:40:58] okay chat can we work on my building
[23:41:00] i don't know so what uh, what do I gotta level up or what?
[23:41:08] Okay, hold on let me see
[23:41:13] Bo okay Bro Okay what's the best bleed weapon
[23:41:15] Bro what's
[23:41:19] The best bleed weapon chat
[23:41:21] Cause not What I'm not I ain't bleed weapon chat cuz not what the mom
[23:41:24] anymore ain't shit oh my god I'm hitting
[23:41:29] on ain't shit how does he bleed both weapons?
[23:41:36] Shit, how does he bleed both weapons bro- oh fuck.
[23:41:42] Yo that shit shit twin bladed! How do you do that bro? Yeah, but Gossian Plea is unique for New Game Plus, right?
[23:42:12] Yes. Oh my god.
[23:42:15] Chat, so nobody was gonna take my boo's ass bro.... I don't know what to do bro.
[23:43:13] Okay, hold on.
[23:43:15] Now you can access him going into the village and the other one you can't get it killing someone okay so chat step
[23:43:24] number one chat this is bad step number one what's that number one, bro?
[23:43:32] New weapon.
[23:43:35] Because after seeing that it's like, bro...
[23:43:44] Godskin Pinnacles is first. Let me see something real quick.
[23:44:04] I can't stab myself! uh New new village. I'm sad bro, this shit is fucking ass!
[23:44:08] And the original game is at the top of the map. I'm going to go ahead and do that.
[23:44:22] Oh, he said my shit was ass.
[23:44:39] When will we... Windmill wins.
[23:44:47] Zoom in? Here?! zoom in here
[23:44:54] now
[23:44:57] higher Higher.
[23:45:10] Chesil, nobody was gonna take my builder's ass?
[23:45:13] Y'all were just gonna watch me?
[23:45:43] We did. Everybody did. This way? Oh, not everybody's so fucking helpful right?
[23:45:50] I feel like Swayze said some shit. Now everybody's helpful
[23:45:53] Is it that?
[23:45:56] So, that's no problem
[23:45:59] Go east like niggas just- No okay Alright now niggas is... No, okay.
[23:46:00] Alright.
[23:46:03] Now niggas is navigators, bro.
[23:46:06] Sonny been navigating this whole time! What about gold? What do I go? Yo, Simba shut the fuck up.
[23:46:23] I can hear this nigga singing and it is so fucking annoying.
[23:46:28] So where do I go?
[23:46:33] East? This way?
[23:46:50] No it is not. Wait what?
[23:47:05] This way?
[23:47:07] Down? East? I'm not sure if that's the right way to go.
[23:47:17] I don't know, but it looks like there are some more of them.
[23:47:22] I'll try and find out what they're doing here. so so Should I go down?
[23:48:02] No, it's right there. Oh Wow.
[23:48:22] What do I do here?
[23:48:28] Wait, what?! Wait! what
[23:48:53] wait oh i see it I'm going to say a note. Why are you saying no? This is literally where he marked it at.
[23:48:56] Are you dumb?! dumb
[23:49:09] wait what what I'm gonna go to the next one.
[23:49:32] My nigga slaying.
[23:49:33] He follow my nigga slaying too. I'm gonna make a slave.
[23:49:36] Keep calling my name a slave too.
[23:49:40] Man! They're looking at it.
[23:49:47] This one?
[23:49:59] That was a good shot. Oh, it's this one.
[23:50:04] Wait, y'all saying yes?
[23:50:06] Wait, oh my gosh! Wait, y'all saying yes wait. Oh my gosh wait what?
[23:50:13] This one yes or no I Jack! Jack! chat I'm going to get you. Get out of the way! I got snakes to the right of me.
[23:51:00] I got Mikey to the left of me.
[23:51:02] Where?
[23:51:05] Woo!
[23:51:09] Come on. I gotta... I would have, you know, what they talking about? I can get back Hey I'm Mr. Roller, but keep me in control And lock me up and give me a bit
[23:51:30] But I like niggas for real
[23:51:32] So catch my eye when you actin' like
[23:51:33] I said I'd fuck with my girl's dick
[23:51:35] I'm Mr. Roller, but keep me in control
[23:51:36] And lock me up and give me a bit
[23:51:38] But I like niggas for real oh they're dancing on his Is that the one? So Cheddar, I have to go here.
[23:52:07] I have to go here.
[23:52:08] I have to go here.
[23:52:09] I have to go here. This is KILLABLE!
[23:52:15] Holy sh**.
[23:52:18] Okay, I might say yes. yes so Him? Him?
[23:54:50] Him?! Him? Him? so so so so so Keep going! so so so Yo, big damage in this game. Big damage in the game is so...
[23:54:52] Bro it is SO satisfying
[23:54:54] bro. Like
[23:54:56] It's so satisfying
[23:55:00] Alright now
[23:55:02] what?
[23:55:05] I gotta get another one right?
[23:55:13] Where's the other one? girl girl
[23:55:42] i'm looking at the vms DMs. Eternal City.
[23:55:48] Oh, Eternal City? Where's it at? Eternal City is like... I took a teleportation right?
[23:55:56] I have it!
[23:56:03] I do?
[23:56:07] Where?! Where? so How do you sort this shit?
[23:56:43] Yeah, how do I...
[23:56:47] What's the best way to what's the best way to do it? All the things.
[23:57:00] Oh, I don't got it right so
[23:57:09] my buddy said I do that? This?
[23:57:32] I don't think this is it.
[23:57:37] Okay, but...
[23:57:42] Yo, Eternal City! Okay, but... I-I
[23:57:45] Yo! Eternal City!
[23:57:47] Did he send it?
[23:58:33] ... so so I put my from off of my phone chat with child where I go eternal city Eternal City Oh what?
[23:58:36] Let me send it Listen to it.
[23:58:43] Yo, Sonny!
[23:58:49] Yo chat how did I get to Autonom City? Oh my fucking god chat just fucking help me.
[23:58:53] All right here. Oh You sleep okay now what I was Oh, he's sleeping. I'm going to go ahead and do this. I don't know what's happening here. I'm just going to keep going.
[23:59:20] I'm not sure if it's a good idea or not, but I'll try my best.
[23:59:21] I think that's the only way we can get out of here.
[23:59:22] I'm going to take a look at the other side of the road.
[23:59:23] I'm going to go back up there.
[23:59:24] I'm going to go down one more time.
[23:59:25] I'm going to go right over there.
[23:59:26] I'm going to go left.
[23:59:27] I'm going to go right over there.
[23:59:28] I'm going to go right over there.
[23:59:29] I'm going to go right over there.
[23:59:30] I'm going to go left. I'm going to go right over there. I'm going to go right over there. This? River.
[23:59:48] This? Oh! I swear, do I go there?
[24:00:34] Do I go there after this?
[24:00:42] The one you just sent me?
[24:00:45] No we're just getting a new weapon Sonny how the is sunny up they just say you asleep so I don't know. Chat, where do I go?
[24:01:19] I just need instructions real quick, chat.
[24:01:21] Chat, all I need is the instructions bro.
[24:01:23] Where's the next weapon?
[24:01:25] The other one.
[24:01:26] Where's the other one?
[24:02:12] You have to be kidding me! weapon the other one this is another one you have it no i don't so so I'm so confused.
[24:02:30] Oh no... Oh my goodness bro. Chat nobody's being direct, I'm seeing mad different shit bro!
[24:02:36] Nobody is being direct right now bro.
[24:02:38] You're not all saying the same thing bro Go what? bro what
[24:03:37] go back to the grace wait it's sway not vip so I'm going to go get him. Sway tight real quick. He is good now, he should be good.
[24:03:41] Alright man go to the green stand.
[24:03:45] Pin it pin it pin it pin it pin, pin it, pin it, pin it, pin it, pin it, pin it.
[24:03:55] Go to the grace tent and just go straight straight i'm at the grace
[24:04:00] let's go straight
[24:04:05] everybody just repeat what Swayze said.
[24:04:08] Okay?
[24:04:12] And then we'll be stairs, and I'll take you down. okay so I'm going to go this is the right way to go.
[24:04:54] What grace have I got?
[24:05:01] Another one.
[24:05:06] Well, Grace is way closer.
[24:05:12] This one? is way closer.
[24:05:15] This one?
[24:05:20] This one?
[24:05:23] Or this one.
[24:05:27] This one.
[24:06:42] Okay... Okay. not this way so so on that so Waterfall? Here? so. Alright. This way?
[24:07:14] Okay...
[24:07:18] I gotta make this boss right here
[24:07:22] wait what no i remember this so so so so so so I'm not going to let you get away with this. Don't move, bro! You fucking cock-blocker! so so so so so so so so so We came back and we had a glow up. We came back, and we had a glow up, chat!
[24:10:47] Yo that first time, bro SQC offered me $100k bro.
[24:10:53] Remember that time!
[24:10:54] Crazy
[24:11:00] Alright now what? I know what Oh TRIOOOOOOON!
[24:11:24] No, I'm gonna use...
[24:11:26] TRIOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN No, I'm gonna... Gideon!
[24:11:28] Everybody says W. Gideon
[24:11:30] with the five fucking gifted
[24:11:32] W-fucking-mans man
[24:11:40] Wait man's me wait that said no don't go wait don't go yet but do I not go yet am i
[24:11:43] missing something oh fuck he took the
[24:11:46] gun on that.
[24:11:51] Did we jump the gun?
[24:12:00] Say yes if you're supposed to go back. Say no if we, if we good.
[24:12:02] Nighthawk's with the tank captain thank you so much!
[24:12:06] Okay they said... Thank you so much.
[24:12:11] Okay, they said... Oh shit
[24:12:33] Damn, coffin coffin You don't need that now?
[24:12:47] I don't need that now?! So what is y'all saying?
[24:12:50] T-Chat,
[24:12:52] What the fuck are y'all saying bro? Yo chat, tea up. Everybody smack each other in the face
[24:12:56] Chat just start fighting each other
[24:13:00] Everybody shut the fuck up, bro.
[24:13:08] I don't need it right?
[24:13:10] Sway do i need it? Sway, do I need that right now?
[24:13:13] The car finsh should take my...
[24:13:19] Alright. So
[24:13:21] I have to upgrade
[24:13:28] so so what's up with this and this these two Guess who's broke
[24:13:49] Broke again
[24:13:51] KC's broke
[24:13:53] Tell a friend Guess who's broke Guess who's broke. Tell a friend.
[24:13:55] Guess who's broke?
[24:13:56] Guess who's broke?
[24:13:57] Guess who's broke?
[24:13:58] Guess who's broke?
[24:13:59] Guess who's broke?
[24:14:00] Guess who's broke?
[24:14:01] Broke, broke.
[24:14:02] Na na na na na na na na na na na na na na na na
[24:14:18] Yeah, in the first playthrough,
[24:14:19] I ain't gonna lie.
[24:14:23] In the first playthrough, nobody should be able to um...
[24:14:24] Well, I wasn't even broke.
[24:14:26] In the first playthrough, nobody should be able to use this though
[24:14:30] And then like once you beat the game
[24:14:32] You should be able to use this
[24:14:34] Cause then you understand like
[24:14:36] To get quick bo, right? No cap.
[24:14:39] Because in the first one you could walk through,
[24:14:43] you literally can be over leveled.
[24:14:49] Like a mothafucka!
[24:14:57] You used it? No I didn't.
[24:15:00] I farmed here and there, but like...
[24:15:02] I was on some late night shit
[24:15:08] Not the burn, I didn't use the bird.
[24:15:10] I had to fight for my shit.
[24:15:12] I didn't use the bird, I fought these little niggas.
[24:15:14] They can now rest. Fuckin' fucker. so I'm talking about some sort of relic and shit.
[24:15:43] Like, I hate when I do some shit
[24:15:45] And y'all always just...
[24:15:46] Y'all just start spitting some other shit
[24:15:48] Like bro that shit is annoying
[24:15:50] Can we all be on one page Now, let's see if we can get the Wait, what do I need?
[24:16:23] What do I need?
[24:16:25] Oh, it's a monster. Who do I need? One of each, right?
[24:16:29] Should I have one in each? They won't, okay.
[24:16:35] I'm going to go ahead and get the other one. 12 from each.
[24:16:46] They won't, okay?
[24:17:00] Okay. I got two.
[24:17:04] Look, every time I scroll it will be like good or no.
[24:17:11] Ready? Good or No for how much i got held
[24:17:26] so how much do i need 10 more? So this much? uh so so Quickmuff. Check quickmuffs. I'm going to save this for you.
[24:18:15] Oh, that's a good one. I say sweet. so I only got 14.
[24:18:49] I only get 14 of these chat. chat No look, it's only said 4.
[24:19:08] Oh I need more runes? Wow.
[24:19:19] Damn!
[24:19:21] Am I broke? Well, I know I got some shit, man. Colby?
[24:19:44] Colby? I'm sorry. Kobe?
[24:20:12] Kobe? I'm sorry. Coby!
[24:20:47] Coby? I didn't get my shit. Kobe!
[24:21:07] I gotta upgrade a weapon, that's why I'm farming.
[24:21:17] Kobe!
[24:21:20] Kobe!
[24:21:25] Kobe? Kobe!
[24:21:42] Kobe! Kobe! Kobe.
[24:21:45] Kobe?
[24:21:49] Kobe!
[24:21:53] ... Kobe!
[24:22:29] Oh my god, he didn't die. He didn't die he didn't die bro Colby! Kobe. Bro.
[24:22:36] Bro! Bro.
[24:22:40] BRO!
[24:22:46] Oh my gosh, man.
[24:23:01] Wait the running sword is the end dragon beast?
[24:23:06] Is that the end beast sword?
[24:23:12] Are you dumb ass to go rebuild and put up my faith, dumbass? How the fuck would I do that?
[24:23:14] I know it's faster but like...
[24:23:16] It's a fucking waste.
[24:23:32] It's my career, not yours. It's MY career, not yours!
[24:23:40] Hold on, A-Bouggy's calling me.
[24:23:43] I'm on the game!
[24:23:45] I'm gonna swing!
[24:23:49] Game?
[24:23:50] I'm literally on outer ring bruh
[24:23:53] But i've been playing this
[24:23:55] Gang, I've been playing this shit
[24:23:57] Yo, I've been playing this shit
[24:23:58] I've been playing this shit for 73 hours bro
[24:24:04] Yeah three hours, bro. Yeah.
[24:24:08] The chat the chest that was good
[24:24:11] to
[24:24:13] get out of the show I said, as a matter of fact, chat with the fuck is good. Chat.
[24:24:15] Why y'all not at the show?
[24:24:20] Now you're playing this.
[24:24:21] I'm trying to beat this shit, bro.
[24:24:25] I got to pull up to one though, you heard?
[24:24:31] What city are you in?
[24:24:35] Oh my god!
[24:24:40] Madison Square Garden?
[24:24:43] Nah, oh my god I'm stupid bro.
[24:24:45] Fuck, I'm heavy. that's crazy you want to
[24:24:46] all right yeah it is
[24:24:51] yeah chad he on tour now yeah i'm pulling up so i'm gonna put
[24:24:54] someone though bro i ain't gonna lie.
[24:24:59] All right, bet you no more.
[24:25:00] I'll pull up.
[24:25:03] Send the dates.
[24:25:05] All right, buddy.
[24:25:08] Bro, man. Hi, what's up? Aight buddy. It's Bo Madison Square Garden chat.
[24:25:12] Chat the garden chat i don't know i don't know if y'all know but when bookie perform at the garden he puts on this is what that jungle dude oh
[24:25:34] my it get locked like it get wicked.
[24:25:47] Oh my God, that would have been loud. That's the city too?
[24:25:50] All right chat I'm gonna go back.
[24:25:51] You think I got enough rules to go back?
[24:25:53] I got 112 thousand.
[24:25:57] Is that enough?
[24:26:00] No!
[24:26:01] What?! I'm trying to get this over with.
[24:26:18] Wait, how am I doing this?
[24:26:30] What are you looking at, you idiot?! Well you're not lying, ya deadass!
[24:26:33] No way, you're not deadass.
[24:26:41] Oh my fucking god.
[24:26:45] I think i dead ass. I'm not sure if this is the right way to do it, but I'll try.
[24:27:00] I don't know what's going on here... Oh yeah, you got that ass, bro. Man, oh my gosh!
[24:27:28] I die here?
[24:27:32] Yo, y'all shot me 200?
[24:29:10] They say 300 bro. so so so so so so Do I have enough just to know, bro? I keep saying, hey,
[24:29:11] hey,
[24:29:13] I'm not about to rebuild to find a fucking to put my faith at 22. so so Damn.
[24:29:51] Damn! Damn. Damn. Damn. Damn. Damn. Damn. Damn. Damn. Damn. Damn. Damn. Damn. Damn. Down! Down!
[24:30:06] Down!
[24:30:07] Down!
[24:30:17] Why I say stop? I can't stand these niggas bro.
[24:30:19] I cannot stand them.
[24:30:21] Why I saying stop? Stop! Why'd I keep saying stop?
[24:30:49] Why this shit be pissing me off bro, I swear to god that'd be annoying bro.
[24:30:53] Oh my fucking God bro. What do I need now?
[24:31:07] What do I need, seven?
[24:31:14] How many? Not somber.
[24:31:41] How many? How many of seven do I need? How many? How many of seven do I need?
[24:31:43] How many? Right here?
[24:32:05] How many of 8? I got 11. How many of 8?
[24:32:10] 12? 13.
[24:32:21] Do I need some more or no? team
[24:32:45] do i need some more no What the fuck?
[24:32:51] Have you ever felt the curse, the Pox upon your head?
[24:33:08] Apparently you are but have you no luck of being alone. you know that nigga fucked up
[24:33:43] now Now... so Ancient dragons with a stone.
[24:33:52] With them dragon stones, I got one! Why is that saying no?
[24:33:56] Oh you got two.
[24:33:58] I'm just broke, I'm just broke.
[24:34:03] God damn, bro.
[24:34:05] Being broke sucks.
[24:34:07] Oh my gosh.
[24:34:09] Nail check.
[24:34:39] What the fuck? so I'm going to go ahead and do it. Chow, how much rules you think I should get?
[24:35:32] Right here how much how much rules you think i should get right here like 10 000 20 so so so All right.
[24:35:40] 73 hours chat, we officially made it chat chat we just passed over the fucking three day line bro.
[24:35:41] We just passed over the fucking three day line bro
[24:35:50] three days bro so so That means it's maxed?
[24:36:25] Did I just sell it?
[24:36:31] Oh my god!
[24:36:38] Oh, it's Mismax. Okay... It's next
[24:36:42] Okay
[24:36:49] So I put another katanas bro holy what should be in the right hand what
[24:36:55] should we in the right hand How do I check to duplicate?
[24:37:14] How do I check? I'm gonna drive. Huh?
[24:37:42] Ooh, yes! Blur. Blur. Yes! Blood?
[24:37:45] Get the blood one again.
[24:37:49] This one, right?
[24:37:59] Oh that was my only one.
[24:38:09] So now which one now what's on the upper right what's under my pole right Coriolis And then what
[24:39:13] oh so Blood, right? Okay.
[24:39:16] Babe, I've got a call now.
[24:39:18] Now what do I do? What do I do.
[24:39:24] It is a cone.
[24:39:40] Make it blood? Wait, a cart only helps with what? Jump attacks? A cart only help with jump attacks?
[24:39:46] What armor do i need, is it gonna make me medium
[24:39:50] Is it going to be light still? I need to be light. Sunny medium is going to be light still i need to be like sunny i
[24:39:52] need to be i need to be like i need to be like bro
[24:39:56] i can't i can't
[24:40:05] where's that? Oh shit, Chad. Ooh. Ooh!
[24:40:17] Respect? I don't have the LeVar.
[24:40:52] Should I just try it? Should I just try it? Oh my gosh bro fuck I think this armor that's needed well always need it bro well arm almost need it
[24:41:00] where bro where
[24:41:03] why you say respect we don't get the we don't got the LaVar shit.
[24:41:13] Oh, I have it!
[24:41:16] Is that a chest?
[24:41:17] What type is it?
[24:41:45] Is it a helmet, Chess? I don't have it right? Or is it this? I don't know.
[24:42:09] Undercity? No. So, Can I go to Comfort?
[24:42:35] Uh, Sunny or no.
[24:42:41] Go to Glazing', Glazin' Hill.
[24:42:45] Y'all welcome to Glazin' Hill! I'm going to right way, right? Why do these weapons actually look fire? Wait, so what?
[24:43:27] Oh my god.
[24:43:30] What's my...
[24:43:33] What does my Lts look like now?
[24:43:42] Wait, I don't have a mana attack?! So I might as well put that down, no?
[24:44:00] So jump effect is my best. Wait so should I not- Should I not put
[24:44:06] Okay but s-so should I put jump claw on?
[24:44:11] You don't think so?
[24:44:18] What do I swap out?
[24:44:20] Golden braid, turtle
[24:44:24] Blood. I need the blood right? Dragon right?
[24:44:28] Okay now we're thinking everybody Dragon, right?
[24:47:18] Chat now we're thinking everybody spam light bulbs. Everybody spam light bulbs. Now we're thinking so so This way? so i'm gonna destroy every wall so What do I have to go? Damn! What the fuck? so Where's that? so What the fuck? Is it that? No. so so
[24:47:21] the skeletons chat.
[24:47:54] God damn where I go now? so I'm not sure if you can see the difference between the two. The first one is a bit more difficult to hit, but it's still pretty good.
[24:47:59] It's also very easy to get out of this room. so I'm going to try and get him. I don't know what it is.
[24:48:32] Stolen some key... How deep?
[24:48:37] My nigga got down.
[24:48:38] Raptor tunnels, dragon. rapid tunnels
[24:48:47] dragon
[24:49:19] holding God damn! Holy shit. Oh shit!
[24:49:24] Oh shit!
[24:49:35] OH SHIT! Oh shit! Now respect
[24:49:51] Nigga I don't have a
[24:49:53] Lavar shit
[24:49:54] Nigga
[24:49:55] Nah Chetna
[24:49:58] I gotta do a new girl now
[24:49:59] Oh yeah cause I don't need mine right?
[24:50:12] I don't have a LeVar ball.
[24:50:14] Where's the LeVar, nigga?
[24:51:24] Oh my gosh no well practice so another message Oh my god. I'm not sure if you can see the I need to put this on now. Wait, am I still light?
[24:51:26] I'm medium.
[24:51:28] I'M MEDIUM!
[24:51:30] FUCK!
[24:51:34] Take this off.
[24:51:44] Still good? Okay, it's fine. Alright, what else?
[24:51:48] What else?
[24:51:52] What else?
[24:51:56] Where is the LeVar? Sunny you gotta send a LeVar where's lavar
[24:52:17] sunny you gotta send the var but i don't have i don't listen i don't have it my boy I need some of the- PAUUUUSSSS! oh okay let me see Here's the area beginning.
[24:52:57] Get that one on top. So chat no L2 So I don't got that one? Oh no, I probably definitely don't have that one.
[24:53:13] So chat, NO L2!
[24:53:15] No L2!
[24:53:21] Okay, I gotta...
[24:53:28] Yeah, I don't have oh my god so that means oh my god if you're not do it we don't need that then that means we just it's a lot of shit. Oh my gosh, we can upgrade so much shit
[24:53:56] I don't know I mean, that should have been told me that because I was a jump. I'm going to jump on one fiend, bro. Oh.
[24:54:05] Oh. Is it this way? Savage is lying.
[24:54:31] Where's it?
[24:54:34] Yo, where is it?
[24:54:43] Down, up down what?
[24:54:47] Witch boy let me get that-
[24:54:49] DAMN!
[24:54:55] Just lemme get this over with bro!
[24:55:25] Fuck. it bro so Yo, I'm not gonna lie.
[24:55:27] I don't even think Melania even made me run this much chat.
[24:55:29] Chat, I don't think... Bro!
[24:55:30] I feel like Batman with prep time
[24:55:39] Like boo millennia, let me go get a a room so so all right all right All right
[24:56:28] Is it I wish oh
[24:56:48] Hi chat all right chat time to level up now check what are we you 60 pagore 40 season donuts
[24:57:02] 30 point decks 34 decks
[24:57:48] 60 rk I Like that? uh
[24:57:54] like this Like this? You sure I need that much...
[24:57:56] Wait!
[24:58:01] And darts?
[24:58:02] Yeah, probably.
[24:58:03] All right, chat!
[24:58:04] Everybody spam locked.
[24:58:08] Oh yeah, so you can like vote
[24:58:10] and I could also um jump more because that's gonna take more
[24:58:18] Ah shit chat
[24:58:22] Aw shit chat. Aw, shit chat.
[24:58:26] Aww, shit chat!
[24:58:28] Now it really comes down to timing
[24:58:30] now.
[24:58:38] Now its gonna literally come down to me dodging.
[24:58:49] Okay,
[24:58:52] hope Ashermore's a bleed, I bet.
[24:58:56] Okay, here we go, chat.
[24:58:58] Here we go, chat.
[24:59:00] It's a blood eye. Blood eye. so oh Oh shit. uh What happened? What did I do? Did I just do the same weapon?
[24:59:51] Why am I just...
[24:59:52] I panicked!
[24:59:53] Oh, my God.
[24:59:54] I'm so sorry.
[24:59:55] I'm so sorry.
[24:59:56] I'm so sorry.
[24:59:57] I'm so sorry. I'm so sorry. I'm so sorry. I just do the same weapon?
[24:59:58] But why am i just- I PANICED!
[25:00:10] No one? No one?
[25:00:15] No one? What are ya doing? what are y'all doing whoa oh so I'm not sure if this is the right way to do it, but I'll try.
[25:01:08] I think that's a good idea. I'm not sure if you can see the so so I'm not sure if you can see the Okay, okay hold on hold on hold on.
[25:02:03] Okay okay okay okay okay okay okay, okay, okay, okay. Okay, okay, okay, okay,
[25:02:06] wait, I just gotta get used to it!
[25:02:08] I just gotta get used to it!
[25:02:10] Okay, wait...
[25:02:12] Am I doing a buff wrong?
[25:02:17] Like what are y'all talking about, why everybody keep screaming no every time
[25:02:19] I say...
[25:02:21] How do I do it then?!
[25:02:23] The setup is physics.
[25:02:25] L2 Then solo hand right...
[25:02:32] What? Oh, L2
[25:02:41] Solo hand right... Like that?!
[25:02:44] Boy, you're not lo-
[25:02:45] You're losing me bro uh like that I don't like this I'm going to if you can see the like oh my god Yo!
[25:04:18] Speak English!
[25:04:20] We gotta talk about a buff!
[25:04:25] Fuck!
[25:04:38] Do the fucking exact bend!
[25:04:39] Type it!
[25:04:45] I'm about to break shit. Yo, take the f-
[25:05:01] And I understand it bro, and i understand him but i don't want to get to 800 my
[25:05:08] okay let me let me find... Okay.
[25:05:41] LT triangle left D-pad L2 Yo, can I get a nick like come on i'm not so oh my god Yo. Type exactly what...
[25:05:45] Triangle!
[25:05:47] L1?
[25:05:58] L2! Did I do L2 AGAIN!
[25:06:07] So what the fuck?
[25:06:12] Take out both swords now what so so so so so so so so so Fuck!
[25:08:10] Fuck, fuck, fuck!
[25:08:13] Wait...
[25:08:15] I restab?
[25:08:16] Must must to restab?
[25:08:20] Must must to rest stabbed or no?
[25:08:24] Just leave it. No time, bet. so so I'm not sure if you can see the Okay. Alright, bye-bye-bye-bye-bye-bye-bye! Alright, bye-bye-bye-bye-bye!
[25:09:12] Now we gotta lock in!
[25:09:13] Now this is what we lock in!
[25:09:14] Now this is where we lock in!
[25:09:15] Now this is where we lock in!
[25:09:16] Now this is where we lock in!
[25:09:17] Now this is where we lock in!
[25:09:18] Now this is where we lock in!
[25:09:19] Now this is where we lock in!
[25:09:20] Now this is where we lock in!
[25:09:21] Now this is where we lock in!
[25:09:23] Now this is where we lock in! Now this is where we lock in.
[25:09:25] Now this is where we lock in.
[25:09:26] This is where we lock in.
[25:09:28] Now it's all about dodging bro.
[25:09:29] Now it's literally all about dodging chat.
[25:09:31] Now it's all about dodging bro.
[25:09:35] Now it's all about dodging bro now, it's all about dodging I uh so so I'm not sure if you can see the fire. Fuck! Fuck!
[25:10:28] It's on me, it's on me, it's on me.
[25:10:30] It's on me, it's on me,
[25:10:32] it's on me, so Come on.
[25:11:00] Say huzzah so I'm going to try and get the Huzzah!
[25:11:38] Huzzah! Huzzah! Boom! I'm not gonna let you get away with this. HELLO! Come out!
[25:12:15] No, I can't get to 800, bro.
[25:12:17] I can't. uh oh so No! I wasted it.
[25:13:12] Oh my god, I wasted it.
[25:13:23] Oh my god, I wasted it!
[25:13:26] Oh my gosh five seconds wasted
[25:13:31] all right come on lock him uh so so I'm not sure if you can see the Whoa! Oh my fucking gosh! oh my gosh this thing is beating my ass bro so so I'm not sure if you can see the Bad run, bro. bad one bro, lets actually get a... you know actually bad ones
[25:15:44] oh Yo, yo, yo. These are actually bad runs bro!
[25:15:48] These are actually bad runs bro!
[25:15:50] I'm not even kidding you.
[25:15:52] I'm just saying that this is a good run.
[25:15:54] This is the best run in the game.
[25:15:56] This is the best run in the game. This is the best run in the game. Yo, yo, these are actually bad ones bro.
[25:15:58] These are actually bad runs bro!
[25:16:04] Bro these are actually bad fucking runs bro like come on you would just flawlessly get to
[25:16:12] phase one so uh What? so so so Bro, why do I keep normal hitting bro?
[25:17:35] Why do I keep normal hitting?
[25:17:37] Why do I keep normal hitting?
[25:17:39] I keep normal hitting.
[25:17:40] No!
[25:17:41] Nooo!
[25:17:42] 800!
[25:17:49] Why do I keep normal hitting bro? Jump, jump.
[25:17:53] Because y'all told me not to jump so many times but I just noticed something hold, let me stop doing this shit bro.
[25:18:19] Fuckin' my game man
[25:18:55] There you go come on uh Why there's no blood on this sword? What the fuck? so I'm not sure if you can see the so so I'm not going to let you get away with this. Kai, you're fucking selling me!
[25:20:04] It's not even a Game Noir it's YOU!
[25:20:07] IT'S NOT EVEN A GAME NOIR IT'S FUCKING YOU!
[25:20:10] YO! LIKE DO SOMETHING!
[25:20:12] AHHHHH!
[25:22:13] BOOM so uh so so so so so so so Oh my fucking god! god oh my god yo yo like what the bro like what are you doing
[25:22:17] actually no i'm selling because i i knew
[25:22:20] i like bro i was i could flawlessly get through phase one.
[25:22:23] I can flawlessly get through phase 1 Monika.
[25:22:27] Like come on bro! I'm going to have to do this again. Why is he doing that bro? so so so so so I'm going to get you. How do you dodge that?
[25:23:59] Got it.
[25:24:02] Got this, you know! Shit... so so so so so so so so This is exactly why I need a light roll.
[25:25:45] It's exactly why I need to fucking
[25:25:47] light roll.
[25:25:48] I'm telling y'all niggas, bro.
[25:25:51] Which one is more better?
[25:25:52] My mask
[25:25:53] or my fucking is more better my mask which one which one is better my
[25:25:55] mask or my fucking chest bro
[25:26:01] i'm telling you bro i need to roll better
[25:26:07] which one is better the mask or the fucking chest so so so.
[25:26:55] ....... so so uh I'm not sure if this is the right way to go, but it's a good idea.
[25:28:42] I'll try to get out of here before they start attacking me. so so I like this right now. oh so so so so so so so so I'm not sure if this is the best way to end it, but I think that's a good idea.
[25:31:00] I don't know what to do with these guys... I need to be like i need to be light i'm telling you bro so uh so so so so I'm not sure if the game is better.
[25:32:39] Welcome to my jump attack! Welcome to my jump attack! cape is better I think they came in here.
[25:32:59] On top of the tailsman too.
[25:33:03] Oh I might...
[25:33:05] No, I need that. so so I'm not sure if you can see the so so so so so so so so Fuck! Oh, fuck.
[25:35:21] Fuck!
[25:35:23] Fuck.
[25:35:27] Fuck.
[25:35:30] Come on, come on, come on so uh so i'm medium level right
[25:36:16] i'm medium
[25:36:24] kill me i was medium i just realized I'm fucking videoed, bro. Oh shit chat.
[25:36:37] Oh my god the shit that these niggas performing at?
[25:36:40] In Madison Square Garden, chat?
[25:36:43] Annalie Chopper's performing performing there when he called me i said i need to pick
[25:36:48] up right i gotta pick up please do not call me while i'm so close though Please! so so so so Oh, why does he always catch me with that?
[25:38:02] Why do I still have them legs on?!
[25:38:06] Oh my gosh.
[25:38:20] So nobody told me to take it off? So nobody told me to take it off so so so so so so so so so It's alright, it's okay.
[25:40:10] It's good, it's good, It's good, it's good, it's good!
[25:40:22] It's alright, it's okay
[25:40:26] It's good, it's good is good uh so I'm not sure if you can see the so so Oh my god, wrong fucking flask bro.
[25:41:51] That was a time on my heal I drank the wrong flask. I'm not sure if you can see the so I'm not sure if this is the best way to end it, but I think that's a good thing.
[25:42:39] I don't know what else to say about this game.
[25:42:44] It's pretty much just another one of those games where you have to go through all sorts of things and then get back into the game. so so uh so so I'm not sure on those, bro.
[25:43:58] I'm not even jumping, gang.. Oh, from sun up to sundown.
[25:44:26] Stop telling me to take a break.
[25:44:31] Stop doing that.
[25:44:32] Stop doing that.
[25:44:33] That ass.
[25:44:34] Stop doing that. Stop telling me to take a break uh so so so so so so I'm going to have to go back and get the so so so so so so so I'm not sure if you can see it, but the game is pretty much a so so uh so so so so I'm sorry. so. so... so.. Left or right? I'll tell you how to choose.
[25:50:58] Left side, fish or right steak?
[25:51:09] Just say, steak or fish. Steak or fish?. I just bones.
[25:51:38] This boneless is going to be annoying to eat right now.
[25:51:44] We're gonna do steak. so I'm sorry. chat, chat got a lot bro?
[25:52:16] this shit get depressive bro
[25:52:20] .... Tennessee getting depressing, bro
[25:52:39] Oh my fucking god
[25:52:42] Jesus Jesus Christ, bro.
[25:52:49] Like this shit is more like...
[25:52:52] How am I back here?
[25:52:55] How the fuck am I back here?
[25:52:56] How the fuck am I back at-
[25:52:58] Oh, my gosh.
[25:53:04] You should've saved this shit to play for Christmas, my nigga. oh oh I don't think you understand how bad...
[25:54:16] Look at me, look at my dumb ass bro.
[25:55:43] What am I doing? These are my beds. so.. throw your candle what What What? It's not real, bro.
[25:55:46] Thank you so much for wearing it on my safety.
[25:55:48] It's an electric candle, bro.
[25:55:51] It's a light.
[25:55:57] Hold on. I don't know.
[25:56:06] Jack, eating break! Eating break!
[25:56:09] Because I'm so as that outer ring I've been in the same boss a full day
[25:56:11] from sunup to sundown
[25:56:13] no progress. Hold on.
[25:56:31] I want to show you guys something real quick.
[25:56:36] Okay, I see a video.
[25:56:41] I have to screenshot it real quick because this don't even look real. what is this nigga talking about, chat?
[25:57:04] He's fucking lying.
[25:57:10] What's up everybody? I'm Jeffrey Phillips. Welcome back to Jeff Gang.
[25:57:15] Today I have a very special announcement. We are having our very first guest on the channel.
[25:57:20] Drum roll please.
[25:57:26] It's Cody!
[25:57:30] Welcome to the channel, Cody. Any words for the audience?
[25:57:34] I'm being cool to watch steak videos with me, so until I get him back...
[25:57:36] Mmm! This steak looks good
[25:57:38] Cody! I'd hate
[25:57:40] to miss it. It looks like I'll have to talk about
[25:57:42] something else. um what do streamers even do
[25:57:53] twitch streamer is getting paid to do nothing.
[25:57:56] Of course I'm being hyperbolic, obviously I know what streamers do
[25:58:00] Uh... they stream on the internet
[25:58:02] But streaming is a lot more open-ended compared to other forms of media
[25:58:07] Yes there are still streamers who mainly play video games or vlog like the videos you can find on YouTube but once you get to a certain
[25:58:12] popularity on Twitch, you can just sort of do whatever you want. For example a streamer like Kaisenat he
[25:58:18] can play video games or vlog or he can just sit around and eat food. Of course there's nothing
[25:58:24] wrong with this if your idea of a fun afternoon is sitting around watching
[25:58:27] Kyson and I eat food.
[25:58:29] More power to ya.
[25:58:30] But I don't know, when I sit down to watch some twi- no that was my first time eating African food get it right at that foo-foo okay
[25:58:48] FOOFOO Okay? Foo-foo!
[25:58:50] Alright?
[25:58:53] Which, and I see Kai Sinat reacting
[25:58:55] to a live news report of a high speed
[25:58:57] chase with his mouth wide open and saying nothing while a
[25:59:01] chat full of random statements and emojis fly by at a pace no human could ever read.
[25:59:05] I'm not gonna lie, but part of me is thinking what the hell is this he's not even doing
[25:59:13] anything to provide entertainment and i get that a stream isn't supposed to be an action-packed
[25:59:18] adventure and a lot of people watch streams just for the comfortable feeling
[25:59:21] of watching a person be themselves.
[25:59:23] But I think it's gotten to the point where some creators
[25:59:25] are getting too comfortable
[25:59:26] or even lazy with the content they're
[25:59:29] putting out. So much of it, at least when it comes to the popular creators
[25:59:33] feels so mindless even down to the titles of the stream
[25:59:37] We are no longer doing titles that describe what's happening
[25:59:39] Bro! Out of all people
[25:59:47] With the word laziness and providing good content he puts my name into this?
[25:59:52] There's no way. There's no way. There's no way!
[25:59:54] There's absolutely no way!
[25:59:56] No, like, literally there's no way!
[26:00:02] He got a big sign right now
[26:00:04] He gotta correct himself
[26:00:06] But there's no way
[26:00:08] It's happening in the stream
[26:00:10] No, that would take too long to process
[26:00:13] Instead we're just doing Good stream Click here no, that would take too long to process.
[26:00:14] Instead we're just doing good stream, click here. And nothing
[26:00:16] displays more how little effort some creators
[26:00:18] put into what they put out than when
[26:00:20] they react to videos.
[26:00:22] Feels illegal to know.
[26:00:29] Look videos. This feels illegal to know. Look how much outfits they are putting in this garment bag. You will find the best streamers on Twitch literally just watching a video and adding
[26:00:34] nothing to it. It's just pure, watching a video and adding nothing to it.
[26:00:35] It's just pure, watching a person watch a video. my nigga, I want you to go watch
[26:00:45] five videos
[26:00:47] of Zeus and Bilu.
[26:00:52] I want you to go watch
[26:00:53] five videos of Zeus and Bilu
[26:00:54] and then come back.
[26:00:58] Okay? five videos of this and below, and then come back. It's changed from the pointlessly convoluted crap
[26:01:01] that so many screenwriters churn out
[26:01:03] just to try to look smart.
[26:01:05] Anyway, on with the- Let's go.
[26:01:12] No we don't want to see your reaction
[26:01:16] no no no Some no, no!
[26:01:17] Some of them like xQc aren't even in the fucking room when they react.
[26:01:22] Dual buildings have merged into...
[26:01:32] ...allowed various war... What are we doing man? When did this become acceptable as content.
[26:01:35] Nobody clicked on your stream to watch a smaller version of a video they could find on youtube bro said be right back and by
[26:01:41] the time he came back half the video was over all right chat i'll be right back i gotta get cody shine as an individual
[26:01:58] all right um i couldn't find him.
[26:02:00] Now don't get me wrong, there are still plenty of streamers who don't react to videos in a completely lazy and shoehorned way
[26:02:06] And those people I don't have a problem with whatsoever
[26:02:09] This is an issue much less
[26:02:11] for the concept of reacting to videos and more with certain creators who just
[26:02:15] use videos so they don't have to put effort into their own content, and
[26:02:19] there's no creator that's a better example of that than the aforementioned
[26:02:22] XQC. Bro
[26:02:24] puts the XQC in extremely
[26:02:26] questionable content. Every time
[26:02:28] he reacts to something on stream,
[26:02:30] he provides nothing to it.
[26:02:32] And I mean nothing.
[26:02:34] Don't believe me?
[26:02:35] Let's watch one of his videos.
[26:02:36] Andrew Tate's controversies have finally caught up to him.
[26:02:39] From a police raid on their mansion resulting in-
[26:02:44] Oh my god, S is gonna watch this video.
[26:02:46] Oh my god, SQC's gonna watch this video!
[26:02:52] Jeez. Hold up, I'm asking you, Jay. I want to know.
[26:02:54] Bro spent the...
[26:02:56] Okay.
[26:02:58] Okay look.
[26:03:00] Okay so true?
[26:03:05] True or false? Okay, so true.
[26:03:07] True.
[26:03:11] But okay look Right? Right, true.
[26:03:20] Okay, okay listen.
[26:03:23] Okay, okay you have to understand um true
[26:03:41] the first 45 seconds of the video saying absolutely nothing.
[26:03:47] And then, the first thing he says not only has nothing to do with the video but also makes zero fucking sense.
[26:03:51] What the hell are you saying?
[26:03:53] It's like maybe I'll give him the benefit of the doubt.
[26:03:54] Maybe he just needed to get
[26:03:55] into the groove of reacting
[26:03:56] and later he's going to have into the groove of reacting, and later he's gonna have some
[26:03:58] hilarious reactions that will make it all worth it.
[26:04:01] Uh nope!
[26:04:02] Of course not!
[26:04:03] 99% of the video is him making a confused face and exclaiming one or two words.
[26:04:09] It says a lot about your video when the most replayed part, aka the part that you think
[26:04:13] would display the best reaction is this.
[26:04:16] ...trafficking for a long time and organizations like the Council of Europe's group of experts on action against trafficking in human beings, also known as Greta.
[26:04:25] Jesus Christ!
[26:04:27] Man learns about horrible thing and is disgusted.
[26:04:29] Wow. Groundbreaking content huh? about horrible thing and is disgusted. Wow, groundbreaking
[26:04:30] content huh? And this isn't just a
[26:04:32] one time thing, literally all
[26:04:34] his reaction videos are like this.
[26:04:36] The latest one he uploaded is actually
[26:04:38] even worse. I shit you not, XQC
[26:04:41] spent the first three minutes of this video
[26:04:43] saying nothing. He didn't
[26:04:45] say a single word.
[26:04:46] ...spin uranium to enrich it
[26:04:49] for you...
[26:04:49] You gonna react to me reacting to to enrich it for you. You wanna know what's funny?
[26:04:52] He gonna react to me reacting to his video
[26:04:58] I'm telling you
[26:05:00] he is going to.
[26:05:02] Then you're gonna watch me react to his video.
[26:05:04] ...as energy or with enough...
[26:05:06] Oh man! Hopefully he doesn't come across
[26:05:08] cash and flight!
[26:05:09] ...to be used in a nuclear weapon. He's putting so little effort into this shit,
[26:05:13] he doesn't even care about giving us good lighting anymore.
[26:05:16] Let's just sit in a black room with the only light being from the computer.
[26:05:20] Fly!
[26:05:21] Kobe White!
[26:05:22] Step back! Holy shit! It's already scummy enough to get paid on stream for such little effort in basically
[26:05:30] stealing other people videos, but as you can tell he also uploads each video to youtube effectively doubling his
[26:05:36] revenue with both youtube and twitch money these videos aren't edited either they're just taken
[26:05:42] right from the stream nothing added to them to make them remotely
[26:05:45] interesting.
[26:05:46] Also because xQc reacts to multiple videos on his stream he's able to upload multiple
[26:05:51] of these videos daily.
[26:05:53] He is pumping out the laziest content known to
[26:05:56] man and is making
[26:05:58] bank. To help you understand
[26:05:59] just how lazy this content is that
[26:06:01] XQC is putting out, let's watch
[26:06:03] a different reaction video of a streamer alfred reacts to the new
[26:06:07] nintendo direct the only thing i need to do to show you how bad xqc's videos are compared
[26:06:13] to other streamers is show you that in this video if you skip to a random point he will always be talking
[26:06:19] you will never get to a point where he's not commenting on something or reacting there's
[26:06:23] no god could you have hero three is my. I am sitting up in my chair, show me what
[26:06:29] do you got Mark! It would be inconsolable. Story isn't set- Alpharad is using the
[26:06:34] content he's reacting to make more content. xQc on the other hand? If you skip to a random
[26:06:40] part in his video, you'd be lucky if he was even saying one word. XQC uses content as his own content.
[26:06:56] There's such a clear distinction of creativity, and that also
[26:07:00] brings me to another point. Alpharad
[26:07:02] makes videos about video games,
[26:07:04] so he's reacting to video game news.
[26:07:06] XQC is supposed to be a comedy
[26:07:08] channel, right? So why the hell
[26:07:10] is he reacting to videos like that?
[26:07:13] What?!
[26:07:14] No!
[26:07:17] Who the fuck?
[26:07:20] No! Jack, I heard what the fuck no jack at heart that's because he's a gamer right
[26:07:24] he's basically a gaming channel that reacts
[26:07:27] right
[26:07:35] yeah i think I think he's a variety streamer. Yeah, he is just a variety streamer.
[26:07:38] The Everest discrepancy or why hacking
[26:07:41] is the future of war.
[26:07:43] No wonder he's not saying anything while
[26:07:44] reacting, he probably doesn't even understand
[26:07:46] what he's watching. If you want to rely
[26:07:48] on reacting videos for your content
[26:07:50] why aren't you watching videos that you can react to?
[26:07:53] I'm not surprised XQC doesn't say anything
[26:07:56] while reacting to a hacking video
[26:07:57] because what would he say?
[26:07:59] He doesn't know anything about hacking.
[26:08:01] He can't be like, oh this video makes a good point
[26:08:04] but here's my take.
[26:08:05] He's literally putting himself in a box.
[26:08:08] Watch some Try Not To Laughs For All I Care.
[26:08:10] You're a comedy channel XQC make people laugh. give yourself something to work with because i can guarantee you
[26:08:16] you won't have anything interesting don't worry don't worry don't worry..........
[26:10:09] . Ow!
[26:10:12] What the fuck?
[26:10:21] No!
[26:10:24] Ah!
[26:10:30] Ah! Never mind.
[26:10:36] Never fucking mom, bruh.
[26:11:17] I'm sorry. Oh my gosh. Hi. If you want to rely on reacting videos for your content, why aren't you watching videos that you can react to?
[26:11:19] I'm not surprised xQc doesn't say anything while reacting to a hacking video because
[26:11:23] what would he say?
[26:11:24] He doesn't know anything about hacking.
[26:11:27] He can't be like, oh this video makes a good point
[26:11:29] but here's my take.
[26:11:30] He's literally putting himself in a box.
[26:11:33] Watch some Try Not To Laughs For All I Care.
[26:11:35] You're a comedy channel Xqc make people laugh give
[26:11:41] i got you so You gotta get high like this. You gotta get high like me. You gotta get hot like this
[26:12:18] He's so stupid!
[26:12:20] X is so stupid.
[26:12:22] X is so dumb.
[26:12:24] X is so fucking
[26:12:26] dumb.
[26:12:28] That's exactly what he was gonna do. And that's what you can do every single time.
[26:12:30] Chat, that method is so tough, bruh.
[26:12:33] Chat, that method is so tough.
[26:12:35] That comeback will always hit, bruh.
[26:12:38] Hold on, hold on, hold up.
[26:12:39] Hold on, chat. I'll be right back it's a good point but
[26:12:43] here's my take he's literally putting himself in a box watch some try not to
[26:12:47] laughs for all i care you're a comedy comedy channel XQC, make people laugh! Give yourself something
[26:12:53] to work with cause I can guarantee ya you won't have anything interesting to say about
[26:12:58] Australia's Secret Chernobyl.
[26:13:02] But nobody deserves to die.
[26:13:05] XQC watching these video essays is like if tomorrow
[26:13:08] I just randomly uploaded a video about World War II.
[26:13:11] Obviously, I wouldn't be able to make that entertaining.
[26:13:13] What could I possibly add to a video
[26:13:15] about that? What am I supposed to be like
[26:13:17] Hitler did what apparently yes
[26:13:19] because that's exactly what he does
[26:13:21] when normal people see a fun video they want to watch,
[26:13:25] They watch it.
[26:13:26] When xQc does,
[26:13:27] He sets up his stream and gets paid while doing it.
[26:13:29] Yo, fqc did you ban this nigga or some shit bro?
[26:13:33] X, did you ban him
[26:13:36] did you beat them this is not creative content
[26:13:39] this is not reacting to videos this is stealing videos and getting paid to do
[26:13:43] it it's both morally and ethically wrong,
[26:13:45] and it's something that not only he is doing,
[26:13:47] but multiple of the top creators on Twitch.
[26:13:49] And it's ultimately sad to see
[26:13:51] people who are supposed to be the best of the best
[26:13:53] when it comes to streaming, absolutely sleepwalk through their
[26:13:56] content. Another problem with Twitch is some creators will stream for way too long. Now I'm not talking
[26:14:02] about 3 hour streams or 5 hour streams or even eight hour streams.
[26:14:06] I'm talking about when streams get to 12 hours
[26:14:08] long, 24 hours long
[26:14:10] or even the casual 100
[26:14:12] hour stream.
[26:14:27] Okay bitch. Hey bitch. Hey hoe dream. Now he's just dick riding. Now he's dick riding. Now he's dick riding. No, now he's dick riding.
[26:14:28] He's actually brain dead.
[26:14:29] He's actually brain dead.
[26:14:30] No, now he's dick riding bro.
[26:14:31] Now he's dick riding.
[26:14:33] No, now he's dick riding bro."
[26:14:35] On one hand I can see the positives to streaming so long because it's more of
[26:14:40] the creator you like. That's awesome! But on the other hand how could the creator ever keep what
[26:14:45] they're doing interesting for so long?
[26:14:49] That's a trick question.
[26:14:51] They can't. Streams that last for so long consistently just run out
[26:14:53] of things to do. My favorite example
[26:14:55] of this is when Kaisenet had a sleepover
[26:14:57] stream and 11 hours in.
[26:14:59] Oh yeah, he was completely exhausted and all.
[26:15:03] Okay.
[26:15:03] I see what you're doing.
[26:15:04] I see what he's doing.
[26:15:04] Okay.
[26:15:05] I see what he's doing.
[26:15:05] Okay.
[26:15:06] I'll see what he's doing.
[26:15:07] Okay.
[26:15:07] I'll see what he's doing.
[26:15:08] Oh, okay.
[26:15:10] Yeah. He definitely baiting.
[26:15:12] There's no way! All of a sudden, the stream was just four men sitting around
[26:15:14] and doing nothing?
[26:15:17] But at the end of the day, this is also
[26:15:18] what keeps it real.
[26:15:21] Right? Like, can't not be in this environment. We gotta fucking...
[26:15:25] But that's actually not that big of a deal because you know what else these streamers do on these long live streams?
[26:15:30] They fucking just go to sleep
[26:15:33] paul are you dumb like are you dumb
[26:15:38] are you dumb hey bitch are you fucking stupid?
[26:15:43] Hey bitch look at my room!
[26:15:49] You lucky I'm fucking sleeping on the street.
[26:15:54] Nigga I'm asleep sleeping on the street. Nigga, I'm asleep! Nigga you think I wanna be in this fucking room fighting fucking bastards?
[26:15:57] Nigga, I wanna beat this shit!
[26:15:59] Nigga, I wanna go outside!
[26:16:01] I wanna go outside, I'm tired of ALL SIDE! I WANNA GO ALL FUCKING SIDE,
[26:16:03] I'M TIRED OF THIS FUCKIN' SHIT.
[26:16:07] YOU THINK I STILL WANT TO BE FUNNY OVER DAWN?
[26:16:10] AFTER 818 DEATHS,
[26:16:13] 75 FUCKING HOURS FUCKING LIGHTER After 818 deaths, 75 fucking hours of fucking life!
[26:16:15] You think I want this shit?
[26:16:17] You think I'm tired fucking family nigga!
[26:16:29] I got friends nigga!
[26:16:32] What the fuck? Fuck! He's rude bro, he downplaying what niggas is doing right now and I don't like it bro. and for some reason while they're asleep
[26:17:13] their fans will still give them money
[26:17:16] don't do that! As I mentioned
[26:17:18] before, Kai Sanet had a 100 hour
[26:17:20] stream which on paper seems
[26:17:22] pretty much impossible and
[26:17:24] in execution is fucking
[26:17:26] stupid because while yes-thirds of the stream
[26:17:29] is Kai playing video games, how fun
[26:17:31] is that? The other third is just him
[26:17:33] sleeping. Nothing like watching a man
[26:17:35] earn money- Okay, okay, okay. So you had no problem with the guy that was writing to Gaming News
[26:17:39] but you have a problem
[26:17:41] with me trying to beat one of the hardest games
[26:17:43] known to man?
[26:17:46] Wait, you're not
[26:17:46] making sense.
[26:17:50] And then you called...
[26:17:53] ...while he's sleeping, simply riveting content,
[26:17:56] not creepy at all.
[26:17:57] Listen I get why sleeping on stream was normalized for the 24 hour challenges and I'm kinda okay with it if its a one time thing.
[26:18:05] But you don't get to go 4 days in a row of sleeping on stream and getting paid to do it.
[26:18:10] Oh yeah he pocket watching! You broke
[26:18:12] nigga. Hey I'm about to
[26:18:14] OOOOOOOHHHHHH
[26:18:20] Let me calm down bro. Cause he's pissing me off, bro!
[26:18:22] I'm going to be...
[26:18:24] I'm gonna be fucking grinding, man!
[26:18:28] He keep pocket watching, bro!
[26:18:30] You're not going nowhere, bro! You're not gonna go nowhere bro
[26:18:33] you're not going to go anywhere doing that bro and i feel like you're not even
[26:18:35] you don't watch my shit that's all mad
[26:18:40] like bro i'll be putting in mad fucking effort.
[26:18:44] That's ridiculous.
[26:18:45] I mean come on!
[26:18:46] He is just sleeping.
[26:18:48] You can't even put some subway surfers on to hold my attention?
[26:18:51] The crazy thing is Kai may have did this a few times there are
[26:18:55] some streamers who basically make a
[26:18:57] living off of sleeping on stream oh my
[26:19:00] god I cannot wrap my head around how
[26:19:02] sleeping has been normalized for streaming content.
[26:19:05] You tell someone 100 years ago
[26:19:07] that people are earning money by sleeping
[26:19:09] while live-streaming themselves, and they'd
[26:19:11] probably blow their brains out right in front of you.
[26:19:14] Imagine I opened a Patreon
[26:19:15] and you paid me $5
[26:19:17] and all there was was just videos
[26:19:19] of me sleeping. Oh my god,
[26:19:21] that would be so weird.
[26:19:23] But that's essentially what they're doing. guys welcome back to the jeffy p
[26:19:28] patreon sleeping special i'm not doing this i'm actually seeing when i have to sleep
[26:19:35] well i'm not i'm not doing this.
[26:19:36] Let me give you a play-by-play on my last night's sleep.
[26:19:40] You know what, chat?
[26:19:41] We're about to play Outer Ring and never sleep, y'all!
[26:19:43] Who's ready to die?!
[26:19:45] Woo!
[26:19:47] Time to die! Woo! It's time to
[26:19:48] die!
[26:19:52] Yeah, so right there
[26:19:54] I pissed myself a little bit. And
[26:19:56] as much as I want to blame Kaiaisenat and the sleep streamers
[26:19:59] for exploiting their fanbase in Twitch to earn more money,
[26:20:02] the fans and twitch itself are the ones who deserve most of the blame. Of course people
[26:20:06] are going to do sleep streams if it means they can earn
[26:20:09] money while doing it and face zero consequences. I'm not questioning why
[26:20:12] people are sleeping on stream, i'm questioning why are we giving money
[26:20:16] the people who are sleeping on stream? why are we even watching them in the first
[26:20:20] place i know i think i think when i'm saying people should keep their money 100 percent 100
[26:20:26] water was saying 100 you feel me when i'm sleeping niggas can get money but
[26:20:29] Bro!
[26:20:31] Like
[26:20:33] Yeah, yeah
[26:20:34] I feel like he's downplaying me chat
[26:20:35] Some people will say
[26:20:36] Oh but
[26:20:37] I like staying in the chat so that I can interact with the community while they're sleeping.
[26:20:41] And you know what? That's fine.
[26:20:43] I'll give you that, even if the
[26:20:45] chat is mostly nonsensical emojis
[26:20:47] and statements. But dear God
[26:20:49] I don't care if you're in the chat
[26:20:51] You do not need to be donating to the streamer still
[26:20:54] One of the reasons people subscribe or donate in the first place is because
[26:20:57] the streamer gets notified and they'll give him a shout out so it's
[26:21:01] beyond me why people are subscribing
[26:21:02] and donating the only time
[26:21:04] it's impossible for them to get shouted
[26:21:06] out for it. Matter of fact, no
[26:21:08] I will complain about the Twitch chat too
[26:21:10] There is no need to be typing in the
[26:21:12] twitch chat while the streamer is sleeping
[26:21:14] i get it when they're awake it's fun to react to things live and feel like
[26:21:18] you're part of a community what the fuck are you reacting to
[26:21:21] when the streamer is sleeping gonna spam emojis as he tosses and turns
[26:21:25] in his sleep. Gonna put W's into chat when he has a wet dream. It's stupid, it makes me angry."
[26:21:31] The bottom line is you shouldn't be able to sleep on stream and make a profit. I think there
[26:21:36] needs to be some guidelines at the very least because I'll keep it 100, sleeping on stream
[26:21:41] is basically exploiting your audience. You don't deserve their tips just for being live,
[26:21:46] you have to entertain them first.
[26:21:47] But anyway that's just about all I have
[26:21:50] to talk about today.
[26:21:52] I just think some people on Twitch
[26:21:55] really fucking
[26:21:55] they do not try at all
[26:21:57] so who are the payments
[26:21:57] streamers
[26:21:57] I think
[26:21:58] in order to earn money
[26:21:59] you have to try
[26:22:00] at least a little bit
[26:22:01] so
[26:22:01] what's with these
[26:22:04] people getting paid to do nothing?
[26:22:06] There I said it. Title call out. Anyway thanks for
[26:22:10] watching everybody. I hope you enjoyed the video. If you excuse us
[26:22:14] me and Cody are gonna go back to watching steak videos now.
[26:22:19] Mmmmm this steak looks good!
[26:22:21] What do you guys say about it, Cody?
[26:22:27] You don't care?
[26:22:29] Are you serious that you don't care about the steak, Cody?
[26:22:31] I fucking said it! Fuck Cody nigga!
[26:22:34] The fuck are you talking about?
[26:22:55] Yeah, fuck Cody. out Mm-hmm. Mm-hmm. I'm it.
[26:23:14] Wait! What's the chances of me clicking this video and him just talking about other people
[26:23:21] they're hating
[26:23:26] uh me drake baby bronx Drake, Baby Glocks
[26:23:34] Tiktokers Hmm.
[26:23:44] Nah, he baited the fuck out of me.
[26:23:47] And that's a good-ass ratio for the amount of stars he has.
[26:23:54] Te'agla? He better do it. monster's harvest he have tag la he ready to fuck out of me
[26:23:55] he pulls views from hating oh my god
[26:24:00] got last Oh, I got my ass.
[26:24:02] Ah!
[26:24:08] What's next?
[26:24:08] What's next?
[26:24:10] Are we good to hop back on the game?
[26:24:12] I'm pretty full, I'm not gonna lie.
[26:24:20] Copyrighted now!
[26:24:22] Now! No! Chad look, here's the thing right? Why would I copyright it, bro?
[26:24:47] It's not like he's using my content.
[26:24:48] It's not like he's using clips of my shit
[26:24:50] to make more money.
[26:24:53] Why?
[26:25:13] Yeah. Why? I I Excuse me just by hit that nigga though. I'm gonna lie
[26:25:19] Let me solar her I'm a lot solar
[26:25:24] play I'm fucking mad at you, Charlie.
[26:25:37] You didn't even talk? Wait, let me know... Wait, he doesn't even talk?
[26:25:40] Wait, let me know.
[26:25:41] Wait, hold on.
[26:25:41] He doesn't talk chat?
[26:25:45] Wait, is he helping people?
[26:25:47] Wait, he's helping people. I
[26:26:16] Let it help me Help me! What the fuck? Oh my god, he is helping people. Oh my gosh! What's going on? I'm not going to die here.
[26:26:57] I'm just gonna go through this thing. so I'm not sure if this is the right way to do it, but I'll try.
[26:27:22] I think that's a good idea. I'm not going to do shit! uh There's no way!
[26:28:31] THERE'S NO WAY! There's no way! I'm not sure if you can see it, but the so I'm not sure if this is the best way to do it, but I'll try.
[26:28:42] I think that's get a lot of points for that. You don't have to be too aggressive with your enemies, just keep them in mind and they'll come back.
[26:28:47] The only thing I'd say about this game is that it's pretty good. Oh my gosh! I'm not sure if you can see the so Now he's the GOAT.
[26:29:39] He's actually GOAT.
[26:29:42] FOUR MILLION RULES! Four million runes! sqc just ran up on the goblin of jeffrey video what What?
[26:30:13] Wait, already? What happened dude?
[26:30:17] What fucking happened dude? What fucking happened dude? That was crazy
[26:30:19] What happened dude?
[26:30:23] What fucking happened dude?
[26:30:25] That was crazy.
[26:30:34] What happened dude? What fucking happened?
[26:30:38] That was crazy.
[26:30:44] Bro! Bro!
[26:30:49] What happened? Can somebody screenshot this and send it to me?
[26:30:53] Screenshot this please!
[26:30:57] Please!
[26:31:08] Crazy, crazy, crazy, crazy, crazy, crazy. That was crazy.
[26:31:12] Screech this right here, please!
[26:31:16] Oh my fucking gosh bro excuse me, excuse me.
[26:31:33] Yo, let
[26:31:34] me solo her and just help somebody else out
[26:31:36] live chat.
[26:31:38] Chat live! live live first chance bro that's skill bro you
[26:32:14] that's killed oh Oh my gosh, though, chat.
[26:32:16] Like I'm trying to get this shit over with, man.
[26:32:47] Yeah!.. Yo, remind me when I beat him? Make a tweet bro.
[26:32:48] Why you even think about that like bro come on!
[26:32:54] T up, bro.
[26:33:06] Alright. Good little break,
[26:33:08] W-break
[26:33:10] good lil' break
[26:33:12] That was actually a good break
[26:33:14] that shit had me crying
[26:33:16] That was a good video yo know he was hanging but I was a good little reaction
[26:33:21] just now make sure um felix sees that please so so uh so so so so so The I'm not sure if you can see the so so Wait, what?
[26:39:58] What? so so so I'm not sure if you can see the so so so so so so so so so so so so so so so so so Wait, I realized something though chat. I'm bugging on my shots here weaker!
[26:40:00] Is that because I don't have the bleed on?
[26:40:09] Oh fuck.
[26:41:41] Damn! Damn. so Wait, Chi-Tails went to low equip load instead of turtle so you can label the mask i have it do i have it Oh shit. so I'm not sure if this is the best way to do it, but I think you can just go with what's in your inventory.
[26:42:45] I don't know why they're doing that here... so so I'm not sure if you can see the Okay, come on. That was good. that was good. I'm not sure if this is the best way to do it, but I think you can just go with what's in your hand.
[26:44:21] I don't know why I didn't get a chance to kill him before he died, but I guess that was his plan. so so so so so so so I'm not sure if you do this one more time.
[26:44:37] I'll just go ahead and get the last two of them. he's a good boy these are the ones you're not good once so that was your good ones
[26:44:38] they're good ones it's like his health bar is so far uh so I'm going to have to do this again. I got a drop zone.
[26:45:26] But he does attack me.
[26:45:28] He's like,
[26:45:29] he's doing this too?
[26:45:30] That's the only one
[26:45:31] that I can't do bro.
[26:45:33] That's the only... I would't do, bro. I would hate to die
[26:45:35] to that, though.
[26:45:37] I would hate to have them close
[26:45:38] to die to that.
[26:45:56] Fuck you! I'm not going to let you get away with this. Come on! Come on Casey
[26:46:06] Bad one!
[26:46:14] Bad one, oh my god bad one Oh my god, bad one! OH MY GOD MY CONTROLLER!!!
[26:46:25] What the fuck? so Hey, too far Kobe! Come on! I'm sorry, Colby!
[26:47:11] Sorry, Colby!
[26:47:16] Sorry! Sorry, Toby!
[26:47:36] Sorry! For you've been on the last boss for how long? Well, how is a DLC boss harder than a fucking...
[26:47:40] ...Alien Beast! than the fucking outing boost.
[26:48:37] Oh, so I'm not sure if you can see the Oh my god notice how I died a lot from that bro. so so so so What? The controller! Oh my gosh.
[26:49:49] I'm so sorry.
[26:49:50] I didn't mean to do that.
[26:49:51] I was just trying to get the game going.
[26:49:52] I don't know what happened there.
[26:49:53] I think it's a bug or something.
[26:49:54] I don't remember anything.
[26:49:55] I don't even remember how many times I've been in this room.
[26:49:56] I can't remember.
[26:49:57] I don't remember.
[26:49:58] I don't remember.
[26:49:59] I don't remember. I don't remember. I don't remember. controller oh my gosh
[26:50:03] this shit is
[26:50:05] annoying bro fuck
[26:50:07] yo can somebody
[26:50:09] check on how many deaths was I hap- when I walked in to this nigga bro?
[26:50:16] I think he killed you like 200 times bro. Hold your side
[26:50:45] Damn 535! so I'm not sure if this is the best way to do it, but I think you can just go with what's in your inventory.
[26:51:38] I don't know why they're doing that here... so so so so I'm not sure if this is the best way to do it, but I think you can get a lot of points for that.
[26:53:28] This is where we're going to have to go through some more of these I'm not sure if you can see the so so I'm not sure if you can see the Thanks for watching! come on bro so uh so Well, why is he fucking me up right now?
[26:53:28] Chat.
[26:53:31] Like I haven't even got half... Oh, I've only got like halfway one time.
[26:53:34] High! so uh so so When does he ever get up that fast bro oh
[26:54:41] when does he ever get up that fast so uh so so I'm not sure if this is the best way to do it, but I think you can get a lot of points for that.
[26:55:38] I don't know what's going on here... so Oh, my God. Yo, with the long distance attacks.
[26:56:07] What the fuck do I do bro?
[26:56:09] When this shit...
[26:56:11] Oh bro like...
[26:56:13] Bro I wanna get off!
[26:56:14] I wanna get
[26:56:16] off, bro. I wanna get off, bro.
[26:56:18] Oh my god. Die!
[26:57:40] ... The last one brought a lot of stuff so so I'm not sure if you can see the so I'm dying to that. Keep dying to that.
[26:57:44] I keep dying to that bro.
[26:57:46] But no way Ludwig can beat this shit bro,
[26:57:48] That's cap! that's cap that's a cab so uh so so so so so. Nigga you don't think I tried to jump bro?
[26:59:29] It did not register! so so so so so so so so so I'm doing the same thing bro.
[27:01:24] Bro, i'm doing the same thing bro.
[27:01:27] I'm dying the same way.
[27:01:29] I'm dying the same way gang. Okay. so so so so so so so I'm not sure if you can see the Oh my gosh, bro.
[27:03:18] Come on, bro. Come on, bro.
[27:03:21] Come on Kai!
[27:03:23] Kai eventually you gotta just... so uh so I'll make some count.
[27:04:12] But why do i keep doing that so so so so so so so Help!
[27:05:46] Help, help, help.
[27:05:49] This is my last boss help help so so so uh so so so so so so so so so Oh, shit.
[27:09:30] Yo, chat like. uh so so so Oh, bro.
[27:09:32] I'm not going to stream games in Phase 2.
[27:09:33] This is bad!
[27:09:36] Oh my gosh.
[27:09:42] This is so bad. This is so bad
[27:11:54] this is so bad! so so so so Thank you for watching. so so I tried to double heal bro. I feel like he's my a lot. He might be overpowered, my nigga.
[27:11:57] He just might be overpower bro.
[27:12:00] Like all the lights and shit is of it's a little too crazy bro
[27:12:07] like that is My god, this is the first time I...
[27:12:19] Like, oh my god.
[27:12:21] Like, millennia...
[27:12:21] Bro, oh my god.
[27:12:23] This is bad, bro. No, I i don't be honest how bad this is this is bad
[27:12:29] this is really bad Look! I'm not sure if this is the best way to do it, but I think you can get a lot of points for that.
[27:12:52] I don't know what's going on here... Oh my god. am i missing what am i missing is there something like
[27:13:09] like is it something like i've got everything
[27:13:16] every i feel like this shit not moving bro. so uh so so I'm not sure if this is the best way to do it, but I think you can get a lot of points for that.
[27:14:28] I don't know what's going on here... I'm not mad at niggas who left mixed reviews, my nigga.
[27:14:46] I take back everything I fucking said bro! I'm tapping into another type of...
[27:14:59] This shit is hard, bro.
[27:15:08] Bro, am I... What am I missing? What am I missing? I'm not, I can't use a summon bro. What am I missing?
[27:15:09] I feel like I'm lacking something.
[27:15:12] Like phase two
[27:15:17] i'm lacking something okay skill all right funny funny funny but like legit though like so I'm not sure if you can see the so so Holy shit man.
[27:16:28] There's no way Lord of the Rings beat beat this bro i don't believe that uh uh uh uh so so so so glass broke glass everywhere glass everywhere so so so so so There's no way.
[27:19:27] Help me, help me help help Oh my gosh, bro. so so so so so so I'm going to have to go back and get the so so. so I'm texting rage right now.
[27:22:05] I'm texting rage right now.
[27:22:08] Don't play the DLC, bro.
[27:22:15] Save yourself while you can.
[27:22:21] This last bus is like no other. Who else do I want to chat? who else out what's the other one bro
[27:22:53] what star wars Who else do I want? Let me tell Duke. See, bro. Save yourself while you can.
[27:23:21] This last pause is like no other.
[27:23:32] Who else all want?
[27:23:35] Mark?
[27:23:41] Don't play
[27:23:43] the DLC bro.
[27:23:47] Save yourself.
[27:23:53] Save yourself while you can.
[27:23:57] This last boss pause like no other.
[27:24:07] I'm just warning everybody else tonight.
[27:24:14] Did Dante beat it? Don't play DLC, bro. Save yourself while you can. This last pause is like no other.
[27:24:39] Bro, I don't think Ludwig beat this shit, chat.
[27:24:42] Bro.
[27:24:46] Chat, like...
[27:24:49] What the fuck is going on?
[27:24:57] Bro, be honest bro. Am I buggin'? Or does is this has a lot of health
[27:25:09] for one through ten bro, how hard is this shit?
[27:25:24] But it's harder than millennia.
[27:25:27] Bro, this has got to be harder than millennia. There's no way.
[27:25:30] There's no way.
[27:25:31] This is definitely harder, bro.
[27:25:40] I don't know. no way this is definitely harder bro you a better man than me not gonna lie bro this is like
[27:26:01] like i don the last one like the game last time was far because as i'm being
[27:26:05] bosses of getting more lower understanding the
[27:26:07] story
[27:26:15] Oh This one is like, fuck. so so so I'm going to have to do this again. so so so I'm not sure if you can see the so 448!
[27:28:28] Wait... Wait, clip that! No, clip that last one
[27:28:44] could the last one, chat.
[27:28:46] That face!
[27:28:50] The last face!
[27:28:54] ... Click that last phase bro
[27:29:00] I'm gonna see something right now boy
[27:29:06] No no no I'm gonna study this shit bro I'm about to see something right now, boy. No, no, no.
[27:29:07] I'm going to study this shit, bro.
[27:29:08] I'm about to see something right now.
[27:29:13] I'm about to see something right now. now yo we yo pin it!
[27:29:44] Yo pin it!
[27:29:47] Please bro.
[27:29:50] Thank you bro. Thank you, bro.
[27:29:52] Appreciate that, bro.
[27:30:00] This shit's getting bad, bro. Hold on. much He goes like this. It circles.
[27:30:59] Easy, I love this move.
[27:31:02] Oh, 1594.
[27:31:07] That's good right?
[27:31:13] Right? F*** Why was that 448 right here?. 448?
[27:31:45] 448! 448!
[27:31:52] Wait, what the fuck?
[27:31:56] Wait, what the fuck?
[27:32:04] Look at my death count! And hear what I say. What the fuck?
[27:32:33] Nah, bro.
[27:33:05] What the fuck? but that's actually insane That's crazy bro.
[27:33:12] But I do not believe that Ludwig beat this nigga, bro.
[27:33:18] I don't believe it. I don't believe it. So where is this shit? The Aspen beat it? but it's just hard bro live
[27:34:02] so there's not hair.
[27:34:23] The fuck? Can somebody link it to me?
[27:34:45] Come on, there's no way he beat it bro
[27:34:47] I just wanna see the damage that niggas has taken
[27:34:58] Guide you evermore I
[27:35:01] Do evermore
[27:35:03] I fear that you
[27:35:10] Man Oh my gosh, man.
[27:35:44] Where the fuck is this shit at? What's the fight easier.
[27:35:46] The fight one will be the one where I have to do
[27:35:47] the least work, you know?
[27:35:48] So it's like
[27:35:49] I don't honestly mind
[27:35:50] doing another phase one
[27:35:53] to get a chance at a really good phase two.
[27:36:01] I think you get rewarded a bit
[27:36:12] Now I wanna see like is he dying? That was how I got the blue run Is dying. That was how I got fucking up like how fucking up sometimes
[27:36:26] The same Yeah, he technically got the same build as me. Right chat? Like with different weapons.
[27:36:29] Oh my god 22-22
[27:36:31] Back to back 22s
[27:36:33] BACK TO BACK TO BACK 22S Back to back 22s. Back to back to back 22s!
[27:36:38] BACK TO BACK TO BACK TO BACK 22!!!
[27:36:44] BAT- That! No, he's doing straight 2000s.
[27:37:00] Oh my God, what am I missing?
[27:37:02] What am I missing?
[27:37:03] Bro, he's doing straight 2000s! straight to the out there Hey, Woody? I'm gonna die. Oh my god, he almost died.
[27:37:42] Getting grabbed there is fun.
[27:37:44] It's worth the heal.
[27:37:45] I ran out of stamina partway through that.
[27:37:49] First time in this battle really Bro, I ain't gonna lie bro.
[27:38:13] I ain't gonna lie.
[27:38:14] There's no way.
[27:38:15] Yo though okay so nigga I'm not...
[27:38:18] I don't give a fuck.
[27:38:19] Nigga I seen his moves all the time.
[27:38:22] Shut the fuck up!
[27:38:23] I seen
[27:38:24] this nigga's
[27:38:24] all his moves.
[27:38:26] I literally
[27:38:26] dodged
[27:38:27] all his moves.
[27:38:28] I know
[27:38:29] his shit bro.
[27:38:33] I'm just trying to see how much damage the nigga giving bro
[27:38:35] His shit is literally decreasing
[27:38:37] Decreasing the
[27:38:39] Fight easier
[27:38:41] The fight one will be the one where I have to do these work you know
[27:38:43] so it's like honestly mine doing another phase 1 they get a chance at
[27:38:46] a really good face in I think ever worded
[27:39:57] I mean that was how i got the blue run. so so.. Everybody just reading this shit, bro. Like a fucking field trip and I can't even go on it, bro!
[27:40:00] Everybody's just beating it, look! Left and fucking right!
[27:40:04] Left and right, bro. Left and right, bro.
[27:41:10] Left and right. Everybody is just bro let them write everybody's just being this look I don't understand that. It's just actually like lower than mine, right? Cool, all this damage on phase 1 huh? Oh my god I couldn't get around him.
[27:41:18] Oh my God look at his dumbass thumbnail bro!
[27:41:24] Flexin' all the way up there. Look at his dumbass thumbnail, bro. Flexing on niggas that he fucking beat it.
[27:41:27] Like, bro, nobody gonna fuck?
[27:41:29] I don't care.
[27:41:31] Don't fucking give this shit, man.
[27:41:38] I don't even care about this shit bro. Start a chat.
[27:41:51] Hey, try to act all mad cool and shit, bro.
[27:41:53] Fuck you, bro.
[27:41:55] Fuck you you bro.
[27:41:57] Fuck you bro. Sorry chat.
[27:42:08] I read about this other boy's wife!
[27:42:10] Nigga what?!
[27:42:12] What?
[27:42:14] What?
[27:42:16] Nigga what?! What? WHAT?!
[27:42:19] Nigga, what?!
[27:42:28] Sorry chat. Sorry, chap. I really don't know about this other boy's or what?
[27:42:35] What is that?
[27:42:40] We can't understand you, Felix. Somebody said ready to wrap this up or what?
[27:42:51] This nigga speak SQC knees.
[27:42:54] Sorry, chat.
[27:42:57] I was reading about this little boy's board swap.
[27:43:00] Oh my god, he is a fluent SQC needs fucking...
[27:43:04] That is crazy, he is a fucking juicer.
[27:43:07] That nigga speaks Ju and ease, bro. I'm ready to wrap this up, man.
[27:43:28] Let me see how much he hit him for bro so Two.
[27:44:00] Two.
[27:44:02] Man it up so It's literally a skill issue, bro. That's what it is.
[27:44:40] No like its actually a skill issue, bro. It is.
[27:44:53] This shit is crazy, bro.
[27:44:55] I've never ever like this
[27:45:00] nah it's not worth that seven days in because jail ain't it jail is dead ass ass
[27:45:12] rage said he gotta beat it before friday bro please no
[27:45:14] please,no
[27:45:16] don't even play it bro
[27:45:23] save your mental Dante said
[27:45:38] I'm already realizing bro.
[27:45:41] I just ended stream trying to fight a fucking dragon.
[27:45:43] Keep pushing bro.
[27:45:48] I pushed so many times.
[27:45:53] I'm starting to feel pregnant.
[27:45:57] I push so many times, my nigga.
[27:46:03] That's a bar! No that's a BAR!
[27:46:08] That's a BAR! That's a bar!
[27:46:18] Bro, that is...
[27:46:18] That is a bar!
[27:47:49] I done pushed so many times times i'm trying to feel i'm starting to feel pregnant I'm pregnant, last boss, bro. last ball so. so so..
[27:47:54] . so so. Oh, Lord. Yo, I need to pray, Lord.
[27:48:41] Yo, I need y'all to pray, bro.
[27:48:42] We gotta pray for me.
[27:48:43] Like somebody just put in a prayer for me, please.
[27:48:46] Just put a prayer in for me.
[27:49:19] Just put a prayer in for me, bro. Check, like... chat like You know what's so crazy though?
[27:49:22] I still gotta understand that like X died 350 times
[27:49:26] I'm not exclusive at least double that for me um ludwig died a lot of times
[27:49:42] this is endless bro.
[27:49:45] Chat, I swear...
[27:49:48] Yo let me tell you something bro if I beat this I'm smashing my whole PC just for fun.
[27:49:52] I literally don't care no more
[27:49:54] this whole shit getting smashed
[27:49:58] This whole shit getting smashed
[27:50:00] It's just for fun
[27:50:02] Like, i'm gonna get back when it smashes
[27:50:06] Ima break down this whole fucking set. Oh! uh so so I'm not sure if this is the best way to do it, but I think that's a good idea.
[27:50:55] I don't know what you're talking about, but I'll try my best to get through this one. so so so so What do you do there?
[27:52:00] Oh, please try to change your mixed physics.
[27:52:10] It would help the one-hit tank is pointless i can't lie well please help change your mixed physic Like, try to hit for plus... what is a mixed physics?
[27:52:32] Note of flask.
[27:52:40] What's a better one? What's the best one?
[27:52:44] Was that Ray?
[27:52:48] Was that Ray?
[27:52:56] Yo, Ray.
[27:52:59] This shit is hard, bro.
[27:53:04] Man, this shit is from sunup to sundown, right?
[27:53:17] Like it's getting bad. I don't check my I'm I'm
[27:53:18] I'm
[27:53:21] I'm
[27:53:24] I'm
[27:53:26] I'm so first.
[27:53:52] Enhances dodge rolls for a time in mixed physics. Temporally boost intelligence.
[27:53:56] Temporarily boost strength in mixed physics.
[27:54:01] This one is damage.
[27:54:04] What do you guys think?
[27:54:09] Is there better ones?
[27:54:17] Like what's the best one?
[27:54:35] No, like what's the best mix? It gotta be HP right?
[27:54:37] HP gotta be one of the best.
[27:54:40] Right?
[27:54:42] And then one more no There isn't a blessing to help me dodge.
[27:54:59] What do you mean?
[27:55:03] What do you mean?
[27:55:17] This right here?
[27:56:27] What the fuck, you on that. What the fuck is Tony? what's thorny so I'm going to try and get the Oh my gosh, like help.
[27:56:28] But what?
[27:56:28] Like how can I... Okay, how do I get over 2,000 damage?
[27:56:31] Is that just straight levels up?
[27:56:33] That's just straight leveling up?
[27:56:47] Oh! Do I need better dexterity? Like do i level up until it just says 2000?
[27:56:55] How do i know like where should my dexterity be man?! man
[27:57:06] like both the
[27:57:07] think about 2000 bro bro so Dragons Tailwind.
[27:57:37] Yo, is there a tailwind that I'm missing too that can have more damage?
[27:57:40] Hold on which one would I replace though?
[27:57:49] What the hell you got, 40 times. Fuck! so so so so Wait!
[27:58:41] That was basically too...
[27:58:46] Nigga I was doing mad damage.
[27:58:49] I was 22!
[27:58:57] No, 6k yet because he bled.
[27:59:02] But is it because like I'm not I might just be, oh I might not
[27:59:05] It's cause I'm not hitting him head on
[27:59:08] Dude I gotta hit this nigga head on on so I'm not sure if this is the best way to do it, but I think you can just go with what's in your inventory.
[27:59:33] You don't have to worry about getting hit by a bomb or anything like that.
[27:59:38] It's pretty easy to get killed here, so... What's thorny?
[27:59:48] Yo sony get thorny for me.
[27:59:50] Sonny let me know where thorny is at. y'all funny good going for me so you know what the way that
[27:59:54] it's only a testament to your mix flags
[28:01:10] and so uh so so so I think yeah, I ain't gonna lie. Oh my gosh!
[28:01:11] I think I'm just ass bro.
[28:01:14] I'm literally just ass bro. ass so I'm not sure if you can see the so so so so so so That's exactly what you get for being greedy that is exactly what you get for being... Hold on.
[28:03:56] Main map top left ice area
[28:04:05] hold on I can't start from here or can't I?
[28:04:29] Top left. This?
[28:04:30] Oh shit Chat chat
[28:04:42] sometimes in life shit is just not fair
[28:04:45] bro so so so so so. hurrah so so in so so I'm not sure if you can see the What did I just choose?
[28:07:15] What did I just choose?
[28:07:16] I put Grace, huh?
[28:07:17] I put Grace.
[28:07:19] I just put Grace. I put grace i put grace huh dumb ass kid
[28:07:28] dumbass kid.
[28:07:36] Come on man!
[28:10:23] This shit is fucking me up, man. this is so so so Why this can't be the last one? uh so so I'm not sure if you can see the so so so so so The only satisfaction I get.
[28:10:35] And now it's back to the pressure
[28:11:17] and i was right back to depression bro like literally that easy chat so so I I could do it right. uh so so so so so so I'm not sure if you can see the so so Y'all see?
[28:13:29] I gotta roll into that.
[28:14:24] Okay. to that... All of my friends are dead. Leave them in the cold! Put him in a tantrum! so so I'm not sure if you can see the so I'm not sure if this is the best way to end it, but I think that's a good idea.
[28:15:22] I don't know what else to say about this one...
[28:15:27] ...but I do have some thoughts on how we should go with this game. so so Oh, my God. I bet if you ask any player who beat this,
[28:16:13] Hey! How did you beat this?
[28:16:18] They can't tell you.
[28:16:21] They can't tell you.
[28:16:24] They can't tell you. They can't tell you!
[28:16:27] They can't tell you, that was a good one though. That was a good one though.
[28:16:31] That was a good one though, but they can't tell you.
[28:16:34] Get your black ass back to that fucking grace
[28:16:38] always sipping that juice so uh I'm not sure if you can see the so I'm not sure if you can see the so so I'm not going to let you get away with this. You're just a piece of shit!
[28:18:01] Fuck!
[28:18:03] Fuck!
[28:18:07] All my friends are bad at leaving
[28:18:09] anything cold and putting them in a tundrum. so so so We out. We gotta get high like me You gotta get high like this
[28:19:16] You gotta get high like me
[28:19:18] You gotta get high like this
[28:19:20] You gotta get high like me
[28:19:22] You gotta get high like me
[28:19:24] I'm fucking your business alright I'm fucking my wife alright You got me gay, how am I mean? My fucking business all right
[28:19:25] But you're my wife, all right
[28:19:27] My fingers stay motherfucking tight
[28:19:29] My eyes are open behind
[28:19:30] I can't believe I'm alive
[28:19:32] I just realized outside
[28:19:34] I was so ashamed of the mic I'm telling you, can I be your life? I'm a gentleman is i know is I'm gonna get you! I'm gonna get you!
[28:20:09] Get the fuck out of here!
[28:20:15] You guys have been waiting?
[28:20:17] Let's see what we can do. We're going to shoot them. work I'm gonna go.
[28:20:35] Put him on top, and then re-firm it.
[28:20:38] Put him in smoke, and then you re-firm it.
[28:21:23] Put him in a coffin, put him in the coffin! I she and she tell me oh I'm a great kid, you ain't cold, you ain't touchin' I go crazy times, I get last year
[28:21:25] I make up a couple
[28:21:26] I went to six city places with no leader
[28:21:28] I don't care if they got jungle
[28:21:29] And what would just happen to me?
[28:21:30] I'll sit back and talk
[28:21:32] I'm coming your way
[28:21:33] I'm gonna do this shit With the white text on me and I knew it was for real.
[28:21:37] This guy is squishing.
[28:21:41] Let me push the door down.
[28:21:45] She's still trying to find an angel. And of course you can do it again. Just bitching around a little bit.
[28:21:51] I just want to be flowing again, guys.
[28:22:31] 27 and a half forward again so so Oh. Fuck it, fuck it, fuck it, fuck it, fuck it, fuck it, fuck it, fuck it, fuck it. That's how I go way back in the morning. it I'm an emo, back of my face 2-2-2-2-2
[28:22:49] Keep your chance
[28:22:51] Mikey next, hold it baby
[28:22:53] I got one two shots
[28:22:55] Bring another party now
[28:22:57] No fun for the fans I'm a rock star next right I don't know. oh is I think she's a hero. I think she's a genius.
[28:23:55] Bro, come on bro! That was unlucky bro!
[28:23:59] That was a magic move he just did!
[28:25:05] I am the game, I am the lord, I am Eldinor! NOOOOOO! Fuck it! so You gotta get high like me You gotta get high like this me I can't believe I used't think Cardi was fine! I'm tapping the wire And if I want it
[28:25:40] I'll watch me pay class and have no way
[28:25:43] She went to have my shots, she let me serve
[28:25:47] We've been at hell in a dandy
[28:25:49] Hey, I was listening to Big G I hit smoker at New Street Look at the hell with them thingies They are a mess like Da Vinci
[28:25:50] I had Smokka and WeeSweet
[28:25:52] Everybody got that newbie
[28:25:54] The bitch she ain't even been moving
[28:25:56] Honey, who's gonna catch her if they move me?
[28:25:58] Let Skye see movie Shoot out a white jet, groupie.
[28:26:01] Fire a jet jet, loopies.
[28:26:03] Red and dark is like parties.
[28:26:05] Sticking in the daylight.
[28:26:07] Sticking in the daylight, donkeys.
[28:27:05] Explode into astronauts' leaves. like Let's do it. She gonna go, y'all! go crazy she like to test her i don't need a cup really See ya We get on Sunday
[28:27:06] I tell my mom
[28:27:08] I was gonna make it Wednesday
[28:27:10] Be
[28:27:11] Be
[28:27:13] Be a dog E-E-E-E-TAL
[28:28:31] Ssssshhhhhhhhhh so uh so I'm not sure if you can see the so Please Lord, please Lord. I need you Lord.
[28:28:35] Please Lord, please Lord.
[28:28:38] I need you Lord. I need you lord
[28:28:41] I need you lord
[28:28:44] I need you lord
[28:28:47] I need you
[28:28:49] Please lord
[28:30:03] Please lord Please Lord, please Lord, please Lord, priest lord, please. so so so so so I should have healed.
[28:30:04] I should have healed.
[28:30:05] I should have healed. I should have healed. I should have healed Let's go! Go! uh so so so so so so so so so so I'm going to have to do this again. Nice!
[28:32:59] Die!
[28:34:11] It's cool, it's cool. I'm not sure if you can see it, but the uh so so I ain't gonna lie, if I beat this shit, I don't ever want to hear nobody in this house say they have better game than me.
[28:34:13] When I beat this
[28:34:15] there's no debate
[28:34:18] There's no fucking debate
[28:34:19] There's actually no debate That's a fact bro. There's no fucking debate. There is actually no debate.
[28:34:22] That's a fact bro, there's no debate.
[28:34:24] None of these niggas in this fucking house
[28:34:26] has been through this fucking pain my nigga
[28:34:28] I'm telling you it's
[28:34:30] different ball game in this shit.
[28:34:32] There is no debate bro, there is no debate.
[28:34:37] Like after the first out of ring I was like okay
[28:34:40] but bro after the first and this it's like I have oh you got it. You've got
[28:34:46] negative he used match next
[28:34:49] next
[28:34:50] Next next
[28:35:38] Oh next next I'm going to show you why I'm number one now. ah I'm going to try time on this one.
[28:35:52] I'll just have to get the last two of them out before they die. Let me show you how to real quick! Let me show ya!
[28:35:54] Let me show y'all I'm the one gamer.
[28:35:56] Let me show ya!
[28:36:27] Now, let's go for a walk in the park gamer Hey, that was good enough and I ate hey hey that was good enough
[28:37:02] it I was good enough.. I'm going to go ahead and do it. was passing to my man's hands
[28:37:48] trying to be your boy or clown ass nigga. so Let me show y'all wild, bro. No Phantom! Not Duke!
[28:37:50] Not Agent!
[28:37:52] Not Davis!
[28:37:53] Not Chris! KC! Not Davis, not Chris.
[28:37:56] KC! Love in the flesh! Me! me
[28:38:11] me
[28:38:14] mania Me! Me!
[28:38:28] ME! Mean! I'm the best gamer in this house.
[28:38:32] Mean!
[28:38:36] I'm not gonna let nobody take that away from me!
[28:38:42] Fuck.
[28:38:45] I'm fucked. Fuck!
[28:39:05] Me bro, fuck! I don't know.
[28:39:06] The shade's calling me. The shade's calling. The shade's calling.
[28:39:15] Yo, Brody!
[28:39:16] How's your sanity going?
[28:39:19] You on God God bro?
[28:39:23] Yo Deshae
[28:39:25] I'll give you $100,000 if you beat this game
[28:39:29] Nigga, nigga I don't wanna get out to that bitch so I got a kid my nigga game
[28:39:42] you Nigga, who? You! But I don't care. My mama could be on the death bed, nigga
[28:39:46] Yo!
[28:39:48] Nigga, chill, walk in
[28:39:50] I'll be on that game, bro.
[28:39:52] In my hospital, nigga.
[28:39:53] Hot, hot lane, bruh.
[28:39:55] Bro, I'm so confident that you wouldn't...
[28:39:57] You can't do that, bro.
[28:39:59] Bruh, I promise you on everything I love, bro.
[28:40:01] I don't care who's calling.
[28:40:02] A hundred thousand to play
[28:40:04] a video game that's enough jack beth not
[28:40:08] i don't think he could do it I'm telling everybody. I'm telling Paul Nelson himself.
[28:40:14] I'm telling everyone.
[28:40:15] Sheepcoats,
[28:40:16] and you are...
[28:40:18] Hey, how do you feel though?
[28:40:21] What's going through your mind right now?
[28:40:23] This is how i feel bro
[28:40:38] that's how i feel bro
[28:40:43] bro let me tell you something bro like i don't know like i want like how does outside smell like how that shit smell Bro, like shit. Like I was having a good time. Nigga, I was saying something to my family.
[28:40:57] It was a good vibe bro.
[28:40:59] Like what's the real shit nigga?
[28:41:00] I don't know bro.
[28:41:01] Like I don't know nigga you got a...
[28:41:03] How old are you now?
[28:41:03] Like 27?
[28:41:05] Bro.
[28:41:06] You're 34. You know that right? Bro. 27.
[28:41:19] bro the shade i don't miss this but i don't wish it so no like the first time around was like okay, like
[28:41:22] But this boat you know what's you know? It's a hearted. You know what's crazy
[28:41:26] I'm on the last boss Yeah, and then I'm on the last balls. Oh, so this is the last point you're at?
[28:41:29] Yeah, and then I'm finished.
[28:41:31] How long have you been on the last balls?
[28:41:32] For 20 hours, like straight,
[28:41:34] like actually playing.
[28:41:36] You got it though, brother.
[28:41:39] I'm telling you, bro.
[28:41:40] You got this shit.
[28:41:41] I don't know what they've been doing.
[28:41:42] Heel, heel.
[28:41:45] Dribble two to three, nigga.
[28:41:46] You got this shit.
[28:41:48] But I legit been on this bitch... Yo, I ain't gonna lie. I legit been on this bitch, yo I ain't gonna lie.
[28:41:49] I've legit been on this bitch for literally...
[28:42:01] Here's the thing no that's distracting to shay
[28:42:05] because sit there and watch you play that's gonna be distracting bro
[28:42:11] but you boy there's no way
[28:42:12] you can kill an
[28:42:13] elderly boss with
[28:42:14] somebody
[28:42:14] as you see laughing
[28:42:15] hey what
[28:42:16] hey bro these
[28:42:19] niggas laughing at me
[28:42:20] but you know
[28:42:20] what's so crazy
[28:42:21] everybody who was struggling, right? Anybody who was struggling, they all got to like get past it. They all got to like have fun. Like they beat it and they out like they living their best lives Wait, who happened to party?
[28:42:48] What?! Wait barbecue tomorrow. I'm like, shit, what's the barbecue? They said we just beat Elden Ring on some real shit.
[28:42:55] I'm like, damn. Wait, all the niggas
[28:42:56] that... Hold on, hold on, hold on.
[28:42:58] All the niggas who beat Elden Ring having a party right now.
[28:43:00] Bro, yeah, it's just a barbecue nigga
[28:43:02] hella fine shit All different types of shit
[28:43:05] I seen the girl talking about
[28:43:07] I'm giving pussy to whoever be elder ring right now today
[28:43:09] I'm like damn
[28:43:11] Wait wait hold on
[28:43:13] When does it end?
[28:43:16] Oh yeah now that shit over, that's over too.
[28:43:20] Ayy good luck bro, good luck bro! Be safe bro!.. I ain't gonna lie
[28:43:54] I'll beat
[28:43:54] I'll beat Mesmer twice
[28:43:56] Instead of having to do this shit, bro.
[28:44:02] Why the fuck they saying X laughing at me, bro? Oh, he's not.
[28:44:29] Oh my god look how peaceful he looks.
[28:44:33] Chat!
[28:44:34] Look how peaceful he looks
[28:44:49] look how fun that game looks!... Check that, Rubius beat it? it Did Rubius beat a Yes or No? so
[28:46:26] i'm gonna find out right now...... so so ah so I'm not sure if you can see the so so so so so so I gotta stop dodging backwards bro i
[28:49:40] gotta stop dodging backwards i gotta stop dodging backwards but lock
[28:49:44] in bro so uh so so I love you. I got green!
[28:50:50] Am i having to try this super long game? uh I'm not sure if you can see the so so I'm not sure if you can see the so so so I'm not going to let you get away with this.
[28:52:53] Yo, how about y'all make it to where we can feed?
[28:52:57] How about y'all make it to where we can feed?
[28:52:59] How bout the game ma- Okay you're saying 11 Flats. There was no heal area.
[28:53:02] Are you fucking dumb?
[28:53:04] Are you fucking dumb?
[28:53:05] Hey!
[28:53:06] Are you fucking dumb,
[28:53:07] you bitch-ass nigga?
[28:53:09] Do you play Outer Ring?
[28:53:11] Bitch!
[28:53:13] Do you fucking play Outer wing? Bitch Do you fucking Play outer wing
[28:53:13] Bitch
[28:53:14] She like that get me so mad bro. uh so so so so so I died like that the same time, bro. Every fucking time I die like that.
[28:54:56] Shit, every time I die like that bro. Hold on, chat.
[28:55:16] Hold on, chat.. What's that? so so so. When I take time like this
[28:56:29] No when I take time like this
[28:56:30] I go back even better bro
[28:56:31] God damn. Shit. Fuck, she just motivated me. Fuck! I'm joking, I literally just see... so so Again!
[28:57:35] Again!
[28:57:37] Again!
[28:57:40] Again!
[28:57:44] Again, again, again, again, again...
[28:57:49] Again. Again. Again!
[28:58:44] AHHHHH uh so I'm not sure if you can see the so Holy! Holy! Holy!
[28:58:46] Holy!
[28:58:52] Holy! Holy!
[28:58:58] Holy. holy so so so so so so so so Every single time.
[29:00:54] Every single time bro.
[29:00:58] Every single time bro.
[29:01:01] Every single time bro every single time Again. Again! Again!
[29:01:12] Again!
[29:01:13] Again!
[29:01:14] Again!
[29:01:15] Again!
[29:01:16] Again!
[29:01:17] Again!
[29:01:18] Again!
[29:01:19] Again!
[29:01:20] Again!
[29:01:21] Again!
[29:05:09] Again! Again! so Again. Oh, fuck! Again! so so so I thought it was going to go side-to-side. i started to slide the floor there i sort of got side again so uh so so so so so so so so so so Again!
[29:08:07] Again. uh so so so so so so so so I promise you a thousand year voyage guided by compassion. so so so I don't know. Like, I don't know. so I don't know. I'm not sure if you can see the so so so Damn! Again? Again!
[29:09:37] Again!
[29:10:09] Again. in so I don't know why did that. I don't know why did that. I'm not sure if you can see it is i just gotta keep playing bro i just gotta get let's
[29:10:34] just keep just just keep getting used to this, nigga.
[29:10:37] Like that's the only way.
[29:10:40] That is the only way, bro.
[29:10:54] Fuck! I don't know. It doesn't matter, that's the only way.
[29:10:58] Look at it in at the positive now look at that positive bro just keep going again so so so so so so so Again. Again! Again! again again As long as I'm consistently getting to that second phase i'm fine
[29:13:11] i'm fine so so so so Again!
[29:14:07] Again!
[29:14:17] Again. Let's go.
[29:14:20] I got tunnel vision, let's go.
[29:14:22] Let's go! Let's go! Oh! uh so so Again!
[29:15:11] Again! Again. Again? I'm going to have to go back and get the uh so so Really?
[29:16:17] Really!
[29:16:22] Again! Again.
[29:17:25] Again. so uh so so Again. Again.
[29:17:26] Again. again
[29:17:39] ok so so so I'm not sure if you can see the red dot on the screen. It's a little bit of an uh I gotta get consistent. resistant so so I'm not sure if you can see the so so so Again!
[29:20:16] Again!
[29:20:21] Again.
[29:20:29] Again. Again! so so so I'm not sure if you can see the so so so so so so so Again! Again!
[29:22:33] Again!
[29:22:35] Again!
[29:22:37] They made this league overpowered bro.
[29:22:39] I'm not here to play with them.
[29:22:41] I'm just gonna go and kill the whole team. I'm not hearing nothing. He's definitely OP, bro.
[29:22:57] He's definitely OP. Like 100% bro.
[29:23:35] This is like... Oh my god I'm not sure if you can see the Again. Again. Again! so so so so so so so so What is going on?
[29:25:31] Like what is going on chat?
[29:25:34] Hold on.
[29:25:41] Click that somebody click that somebody click that somebody
[29:25:43] click that click that click that. Somebody clip that.
[29:25:44] Clip that, clip that!
[29:25:45] Yup, again, again.
[29:25:46] Clip that.
[29:25:47] Somebody clip that.
[29:25:53] Somebody clip that please Clip it, clip it, clip that last one.
[29:26:17] Clip that last one please.
[29:26:19] ASAP.
[29:26:20] Progress though, progress.
[29:26:21] You check out the progress bro.
[29:26:24] W's for progress, bro.
[29:26:28] Like...
[29:26:28] That's the only thing we got on our side right now, bro.
[29:26:41] It's like there is progress but there is not... What is it called?
[29:26:43] There is progress, but there is...
[29:26:46] Like...
[29:26:47] Fuck. like
[29:27:02] it's progress but mistakes yes his progress with with his bad habits.
[29:27:21] Yes.. Hold on. How do I go to the actual clip?
[29:28:07] Okay, so How do I go to the actual clip? The actual VAR. Is it lagging for y'all? Yo, how do I go to the actual vibe?
[29:28:08] The full video bro. Yo, bro. I'm going to go ahead and start the video. She's not my girl, somebody will.
[29:28:25] She's not my girl, somebody girl.
[29:28:29] Not my girl.
[29:28:31] All of my friends are dead leave me me the code. Put them in a dungeon.
[29:28:38] Yeah, my PC's gonna explode by the way.
[29:28:49] We're definitely going to to reset it, right? Chat. The PC. Like when it hits 48.
[29:28:54] We're gonna think we'll be fine.
[29:31:07] Okay. What the fuck? Is this the last one? right so so yeah good you can see it. Dead again. so so All good, all good, all good. Great!
[29:31:19] Great! uh...
[29:31:36] side were decided to work for it Quick dash, Come in.
[29:31:40] Side angles work for that, right?
[29:31:44] What works for this side works but like you think forward or side?
[29:32:06] Forward really?
[29:32:13] Panic rolls of death.
[29:32:16] Panic fucking rolls of death
[29:32:33] oh my gosh! Chill, chill, chill, chill, chill. Damn.
[29:32:43] You know what the problem is, bro?
[29:32:49] They're adding too much like...
[29:32:57] Okay! Hold on! It's just a too much like okay hold on is that side dash only two hits
[29:33:28] now does he attack only twice? Side. One, two, three, that second one, that beam of
[29:33:32] light that you see is just in case you did mess up so it can instantly kill you.
[29:33:37] Right?
[29:33:40] Look...
[29:33:45] One Look. One, two
[29:33:49] And if you got hit right there
[29:33:51] You get stuck and die
[29:33:53] Cause I dodged it Oh oh hit me a little bit
[29:33:57] panic though look look at me panicking
[29:34:01] and that would have that would have went into uh to uh we know these attacks
[29:34:11] it's just now
[29:34:12] it's on like steroids
[29:34:14] we know these attacks they're just on steroids now you need a stag him? I don't know how to do that. Try it out.. Wait, Chad.
[29:35:17] I walked into this ball Fuck! Anyways, I walked up to this boss...
[29:35:46] ...on 389 deaths.
[29:35:50] And he was like, I'm gonna kill you. 389 deaths.
[29:36:02] 501. Okay but minus like a daaad, like... wait. He didn't get all 500 though. That's not eating it all behind ago
[29:36:17] Did you get off 500 I died like
[29:36:25] And then remember cuz no, no, no, hold on Yes the sunflower added
[29:36:27] OD though stop. No
[29:36:29] Cuz
[29:36:31] Cuz look
[29:36:33] Yeah I did more bosses after that so what was my official entrance
[29:36:44] 5 432 5,432? So, 890 minus 542 is coming almost 350 times that's pretty
[29:37:12] that's pretty like normal but how do I explain this chat I'm not making progress on phase 2 you feel me like i'm not making progress in phase two. I promise you, I should have ended this shit offline, I promise you I should've.
[29:38:02] I knew I shoulda been grinding bro before I started-
[29:38:08] Fuck I would of walked into this bitch level 500
[29:38:12] Facts I don't know what the fuck, I would have walked into this bitch level 500.
[29:39:00] Facts! so so so Again! Again! so um so so so so so so so so I'm not sure if this is the best way to do it, but I think you can just go with what's in your inventory.
[29:40:58] I don't know why they're doing that here... so I'm not sure if you can see the so so so Again.
[29:42:04] I just can't get deep into it bro.
[29:42:07] I don't know how like... so uh so so so so so I'm not sure if this is the best way to do it, but I think that's a good idea.
[29:43:38] I don't know what to say about this one... so so I'm not sure if you can see the so so I'm not sure if you can see the I I
[29:44:46] I
[29:44:48] I
[29:44:50] I
[29:44:52] I
[29:44:54] I I Can't be scared, look look look.
[29:44:57] I know y'all wanted me to heal but in times like that it is
[29:45:01] very important to remain patient
[29:45:05] At times like that that it is very important to remain
[29:45:11] patient. Like you just got to get through that and then heal I'm going to go back and get the Like, you gotta remain calm bro. I'm not sure if this is the right way to do it, but I'll try.
[29:45:46] I think that's a good idea. Like this! That was greedy. was that so so so I'm not sure if you can see the It's fine. Again!
[29:47:22] Again! You got me. Wait, did a building even call me? uh so so so so Really, very greedy.
[29:48:46] One mistake will cost you again.
[29:48:52] One mistake will cost you, again.
[29:48:55] Very greedy.
[29:49:00] The next day so so So, I'm going to go ahead and do that. so so Oh my god so so uh I'm not sure if you can see the I don't like that.
[29:51:08] I don't like that. I don't like that, bro.
[29:51:11] I don't like that right there, bro.
[29:51:14] I don't like that, bro.
[29:51:15] I don't like that, bro.
[29:51:17] Two hits? Two hits? again uh I'm not sure if you can see the so so I'm not sure if you can see the so so I'm not sure if you can see the so so so so so I I cool cool cool that's fine I was looking I was looking at spot a spot
[29:54:06] that's fun I was looking a spot's fine, I was actually
[29:54:11] looking in there.
[29:54:12] I was actually
[29:54:12] looking,
[29:54:13] I could see
[29:54:13] what he's doing.
[29:54:15] Like the
[29:54:15] dash shit
[29:54:16] that we talked
[29:54:16] about,
[29:54:17] I was expecting
[29:54:18] two hits right
[29:54:19] there.
[29:54:20] I keep forgetting it. Let me just let me just let me lock it again uh so so so I'm not sure if you can see the Again! The End I can't get to a thousand bro.
[29:55:50] I cannot get to a thousand bro,
[29:55:52] I cannot get to a thousand bro
[29:55:54] I will not go to a thousand
[29:55:56] I WILL NOT GET TO A THOUSAND
[30:02:15] I WILL NOT GET TO A THOUSAND I will not get to a thousand. so so so I'm not sure if you can see this, but the game is actually pretty much a so so so so so so so I'm not sure if you can see this, but the game is actually pretty much a so so so so so I'm going to have to do this again. The gun! so so so I'm not sure if you can see the so so so so so I'm not sure if you can see the so so so so Okay.
[30:02:17] Three, it's three, it's three.
[30:02:19] So, it's Dash It's three regardless. What I said before was wrong. So it's Dash, it's three regardless.
[30:02:21] What I said before was wrong.
[30:02:23] So it's that, y'all see me,
[30:02:24] y'all see me, y'all see me,
[30:02:25] y'all see me, uh...
[30:02:28] Y'all see me dash that right?
[30:02:30] Y'all see me dash that right? Now see if he dodged that, alright? So
[30:02:33] it's dash. Then it's
[30:02:35] hit, hit
[30:02:37] beam. But so you gotta do
[30:02:39] three rolls. Then you gotta relax
[30:02:41] So it's dash hit it beam relax that's the only one i got down pack so
[30:02:50] that's that's good i don't know now for that rolling one, what do you do right there?
[30:02:58] I missed 50! Who get the 50?!
[30:03:07] BJ Scott! B.J. Scheme?
[30:03:08] Scheme!
[30:03:13] Lie you bro Fucking lie you bro That's love you, bro.
[30:03:16] Let's go to the fucking 50s, Steve!
[30:03:19] Let's go, Steve!
[30:03:21] Let's go, Steve!
[30:03:23] Yo, you know I'm gonna last some, bro.
[30:03:26] Yo, bro, I gotta going to last some, bro! Yo, bro,
[30:03:27] I gotta link up with you and Ski soon, bro.
[30:03:30] For real.
[30:03:31] No kids at it.
[30:03:33] Dude,
[30:03:34] me and Ski
[30:03:35] talked about linking
[30:03:35] soon. Chat, where should me and Ski talked about linking soon.
[30:03:36] Chat, where should me and Ski Mask go for a stream?
[30:03:40] I wanna...
[30:03:40] Like, should we go to like...
[30:03:42] Where should we go?
[30:03:43] What should we do?
[30:03:44] I want this on Lit Shit.
[30:03:49] I'ma... why this one that oh i'll think of it
[30:03:54] skiing with ski mask?
[30:04:09] Yo, hold on! You think Aspen got good connection?
[30:04:12] I don't think so, bro.
[30:04:14] Y'all think Aspen got good connection with IRL?
[30:04:16] I don't know.
[30:04:23] Hold on. It's summertime in that Kingston! What the fuck?
[30:04:34] Wait, it's summertime... Aspen be fucking expensive, my nigga.
[30:04:44] Shit I ain't gonna lie bro, aspen is fucking expensive bro, how the fuck? I'm just fucking expect
[30:07:11] but can happen dying I'm not sure if you can see the so so oh so so I'm not sure if you can see this, but the so. so so so What did I do there? What the fuck did I do there?
[30:07:16] I'm not even gonna die. What I do there? What the fuck do I do there?
[30:07:24] What the fuck do I do there?
[30:07:32] Am I spam rolling back? Or side?
[30:07:40] Oh, god.
[30:07:57] How I do that chat? Like this?! You don't think
[30:07:59] like side on his feet
[30:08:01] to where i keep going around him or should i go like side on his feet like to where i keep going around him or should i go
[30:08:04] like side side and just keep spinning only side side side side side side
[30:08:10] how much time does he do that?
[30:08:17] I'm gonna spam side then. How much time is...
[30:08:19] Like five, like four
[30:08:21] Bro that shit feel like he was like seven times bro.. So we got dash.
[30:09:09] We got dash, hit-hit beam That's three rolls
[30:09:20] Then we got the arm, but he has his normal moves
[30:09:23] Always know what's going with a beam?
[30:09:26] Okay So we got We got, hold on.
[30:09:29] Hold on. So we got dash, hit,
[30:09:34] hit, beam!
[30:09:35] That's three rolls.
[30:09:37] Then we got the normal normal where he comes in one two there's a beam with that
[30:09:44] and then it's three but when he slammed for the beams and dodge it.
[30:09:50] Right? That's what it is. There's a whole bunch of them right?
[30:09:54] Because when you go to the ground, a whole bunch come down.
[30:09:58] Right?
[30:10:04] And then...
[30:10:07] and then we got, um... And the one where he goes like this, when he's like this, a dis just comes out. Um...
[30:10:26] That's all I know so far. And then that purple shit is a lightsaber,
[30:10:28] because we know that.
[30:10:30] And it goes to the rolling shit,
[30:10:33] is spam side, side, side,
[30:10:35] side, side, side, side.
[30:10:37] And then for the rising
[30:10:39] shit, it's run, run,
[30:10:40] run, run, stop. Don't panic.
[30:11:00] I think that the Adam on us is always moves now to only the only thing got a skew over at the hog the hog shit the hog shit the hog shit. The hog shit.
[30:11:06] The hog shit.
[30:11:07] Wait, the bitch whispered in my ear.
[30:11:08] Why I can't stab the bitch in the air?
[30:11:13] But
[30:11:13] hold on what does her shit do chat? What does the hog do?
[30:11:18] Is it just to take you off your focus or what? It does something bad right? It's for love.
[30:11:53] If she catches you twice, ita- death? Oh shit. so The bitch on his back, not him! so I gotta dodge that too.
[30:12:43] I gotta dodge...
[30:12:44] That's a little late attack.
[30:12:46] That's some late attack, bro.
[30:12:55] That's some lateade attack bro.
[30:12:57] Wait the little bitch? Hold on, the little bitch on his back is a nigga?! nigga oh fuck i got the whole lord fucked up
[30:13:10] is that the bitch in there who a little focus in the egg it was that right
[30:13:24] this whole family is the up family bro I'm not sure if you can see the so so so so so so so so so Pretty, pretty, pretty... Gritty, gritty, gritty. And the hug just don't go in.
[30:15:32] Just don't go into that hug.
[30:15:34] Don't go into that hug.
[30:15:36] Don't go into that hug.
[30:15:38] Ah, just don't go into that hug. Don't go under the hug.
[30:15:43] Just don't go under that hug, bro.
[30:15:51] I might need to go distance because oh
[30:15:57] wait jump on the back of her
[30:16:02] or him Or him? so so so so so so I'm not sure if this is the best way to do it, but I think you can just go with what's in your inventory.
[30:17:24] I don't know why they're doing that here... so so so so so so so Okay, that's new.
[30:18:50] Write it down.
[30:18:51] Alright!
[30:18:53] What do you do you do okay that one
[30:18:58] okay that one um you know move where he brings me up and slams me down?
[30:19:08] Is that the substitute?
[30:19:37] Or... or okay so when he's doing that what is he has tunnel vision on that? So... He just goes to whatever direction he's facing? Like no matter what
[30:19:41] he can't follow me? Okay. um so so 7000! Damn!
[30:20:37] 7000 was crazy!
[30:23:24] Damn! 7000 was crazy! Damn. so so so so so so so so so so so What do I do right there? What are you doing? Oh my gosh, this shit. Am I getting better with phase one?.. chat rolling to the left does not work bro.
[30:24:03] Hold on.
[30:24:04] Click that!
[30:24:05] Click that!
[30:24:06] Click that!
[30:24:07] Click that!
[30:24:08] Click that last attack!
[30:24:09] Click that last attack!
[30:24:10] I gotta get that over with.
[30:24:11] Okay.
[30:24:12] I'm gonna go back and do this one.
[30:24:13] I'm going to go back and do this one. I'm going to go back and do this one. I'm going to go back and do this one. last attack i gotta get that on the pack
[30:24:20] yo do we have extra headphones Thanks. Alright. Alright, time to run this shit. Let's tell them about this.
[30:24:58] Did I see progress though?
[30:24:59] Like learning wise I think
[30:24:59] I feel
[30:25:00] I can feel
[30:25:01] Oh shit
[30:25:02] I can feel progress bro
[30:25:06] But y'all saying no but I don't understand
[30:25:09] Oh my oh my god, I'm gonna ask you a question. Yeah, never keep shit realistic
[30:25:15] Like obviously making progress progress bro like obviously bro
[30:25:24] oh because that keep on look or because the nigga keep dying don't mean I'm not making progress
[30:25:41] and there's lagging a little bit. It's lagging a little bit.
[30:25:42] Hold on.
[30:25:43] God damn!
[30:25:44] But my PC is going to fucking explode!
[30:25:48] But my PC is gonna explode but my piece is gonna explode so My pizza gonna explode man.
[30:26:15] Like what the fuck?
[30:26:20] Why is my- no.
[30:26:22] I'm not busy, I'm perfect!
[30:26:26] Like what the fuck?! uh so I'm not sure if you can see the so so Fuck!
[30:27:34] Wait, does Thorny make you get like extra... Wait hold on. Does Thorny Make you get like extra well on the story make you get
[30:27:37] extra um like if you consecutively keep hitting
[30:27:40] a nigga you get higher damage oh but it gives you that's why I'm hitting 7000. uh Damn!
[30:28:14] Damn! Damn! Oh, damn! All that to get fucked?
[30:28:55] FUUUCK!
[30:28:58] You're waiting for 4,000 game I have a fourth out letter 8,000 yo what the fuck?
[30:29:17] Why I can't hit like that in an end game bro?
[30:30:29] Oh! so so Thanks for watching! so so I can get a hit off that! I can get a hit off the rocks! so so I'm going to have to do this again. I got too cocky, fuck!
[30:31:14] I got to cock up the rocks.
[30:31:16] Why you with the rocks?
[30:31:17] Why you gotta get the rocks?
[30:31:19] Why you fucking get the rocks, huh you gotta fucking get the rocks, huh?
[30:31:21] Why you went for the rocks nigga?
[30:31:23] Huh? Why you went for the rocks?
[30:31:25] I got too cocky with the rocks.
[30:31:27] Oh my fucking gosh!
[30:31:32] I got to cocky with the rocks. Wait, does he do that off the rocks every time? so Huh? Yo! Not a lucky recipe to my fallen soldiers.
[30:32:07] Yo, chat!
[30:32:08] What's up with you?
[30:32:11] You're not even in the game. Yo! Now to let me rest in peace with my fallen soldiers.
[30:32:15] Yo, chat!
[30:32:17] Um...
[30:32:18] Does he do that up the rocks phase 2 every time?
[30:32:20] Yo what the fuck my headphones are dying, literally. Is Chris here?
[30:32:44] Now I'm feeling good now.
[30:32:47] Now I'm feeling good! so so so The so I'm not sure if you can see the so I'm feeling good now, I'm feeling good.
[30:34:15] I'm feeling good, I'm feeling good. I'm feeling good, I'm feeling good.
[30:34:21] It's okay, that's okay!
[30:34:23] Chad it's okay bro.
[30:34:24] It's-it's okay.
[30:34:26] Ay ay, it's okay.
[30:34:28] It's okay bro, it's okay bro.
[30:34:31] It's okay. God please god i know you with me god
[30:34:35] god i know you with me yeah helping me right now uh so I'm not sure if this is the best way to do it, but I think that's a good idea.
[30:35:11] I don't know what you're talking about. so so so so so I'm going to have to do this again.
[30:36:17] It's high!
[30:36:20] It's cool! It's cool, it is high.
[30:37:16] It's high. You're safe... I'm sorry, I'm sorry, my fault, my fault. Let's go.
[30:38:07] Come on! uh I'm not sure if you can see the so I'm not sure if you can see the difference between the two. The first one is a bit more so so I'm going to have to do this again. I promise you, a thousand year voyage guided by compassion.
[30:38:55] I promise you, a thousand year voyage guided by compassion. so Oh, fuck.
[30:39:16] Fuck! It's alright.
[30:39:34] Yeah, they one- at me bro. Over and over bro. uh so so so so so so I have balls but a dive bro. I'm not sure if you can see the You can't do that back to back bro.
[30:41:25] Like you can't do that cheesy back to back
[30:41:38] i think it's safe to say uh so so so so so so uh so so Okay, so Rocks
[30:43:42] He definitely has three moves after that
[30:43:45] Rocks
[30:43:46] He has three moves after that. Rocks, he has Steve moves
[30:43:48] after that.
[30:43:51] I'm just
[30:43:52] happy with phase one.
[30:43:53] I'm not even gonna lie, chat.
[30:43:55] Like no cap cap bro. uh so I was stuck at a wall wall, out of wall bro.
[30:44:42] Outta fuckin' wall.
[30:44:44] Give me nothing.
[30:44:45] I dodged your shit but...
[30:44:47] Fuck.
[30:44:50] Again? Again, again, again!
[30:44:53] Again, again, again, again, again, again, again...
[30:44:59] BOOM so How do I look, chat? so Let me not even touch my luck.
[30:45:39] My shit might explode.
[30:45:41] My shit deadass might explode.
[30:45:43] I'm gonna go to the bathroom and get some water. My shit might explode.
[30:45:45] My shit deadass might explode, no cap!
[30:45:50] BOOM
[30:45:52] BOOOM
[30:45:54] BOOOOM BOOOM uh so so so so so so so I'm not sure if you can see the so The so so Patience! Patience, patience.
[30:48:14] How was that though?
[30:48:16] How was that?
[30:48:18] How was that?
[30:48:20] Patience.
[30:48:22] But how was that? Patience bro, how was that?
[30:48:26] Patience bro
[30:48:29] It's good. Oh I had 9 flasks
[30:48:32] That was good
[30:49:29] Bad bad cuckoo good uh so so so Headphones died. Oh my god, that just fucked me up! My headphones literally just died!
[30:49:33] Oh my gosh, no way!
[30:49:37] I'm gonna go to the bathroom and get a new one. I don't know what's going on here. Oh my gosh.
[30:49:41] No way.
[30:49:44] I can't see shit.
[30:49:47] Oh my gosh!
[30:49:51] No! Oh my gosh! No way!. Another one. Deadhead set.
[30:50:33] Deadhead set. Dead headset. Dead headset!
[30:50:37] Charge headset.
[30:50:54] Let's see... so It's both of you, two headsets nigga.
[30:51:00] I need to be here. Yeah what is this?
[30:51:13] Outside okay. Yo, chat!
[30:51:45] There's something very important in this package, bro.
[30:51:49] That you guys cannot see, bro.
[30:51:53] Something very important in this package that you guys cannot see.
[30:51:59] Like, literally
[30:52:00] if you guys see this
[30:52:02] your life could change.
[30:52:05] No, like actually
[30:52:06] hold on
[30:52:07] let me confirm.
[30:52:09] Oh my god.
[30:52:13] Oh shit!
[30:52:21] I'm not fuck it up.
[30:52:25] Oh shit!
[30:52:29] Oh my god.
[30:52:31] Yo!
[30:52:38] Yo, I gotta be very safe with this though. Fuck!
[30:52:47] Fuck! See? I think at the end of the stream
[30:52:49] I'll tell you what it is.
[30:52:53] At the end of stream, I'll tell you how it is. At the end of stream...
[30:52:55] I'll tell y-I'll tell ya what it is, Shaq.
[30:52:59] Drug deals!
[30:53:03] Merch drug deals merch sex toy gt wait Ah!
[30:53:26] Ah!
[30:53:36] Medic!
[30:53:40] Fuck!
[30:53:45] Ah! Ah, fuck class.
[30:53:51] Ah!
[30:54:00] Oh, I'm leaking.
[30:54:04] Ah shit.
[30:54:09] Ah!
[30:54:12] Fuck!
[30:54:14] The glass from earlier. Fuck!
[30:54:23] Ah, fuck! Ah, shit! Oh yeah, that was ketchup chat.
[30:54:43] Yeah I put some ketchup, he has a skit. Oh my god.
[30:55:08] Hold on, let's catch a wound.
[30:55:12] Blood loss. Shut the fuck up bro.
[30:55:16] Sweat...
[30:55:19] I put in here. I couldn't...
[30:55:22] Come on, man. Let me move these glass shards, bro!
[30:55:25] What the fuck?
[30:55:45] ... I'm going to go ahead and get out of here. uh...
[30:55:55] teleporter Turn off all that. In your ass bro, what?. Wait, hold on.
[30:56:21] Hold on.
[30:56:22] Why are Rape Dance kind of fire? Wait, hold, why Rape Dance got a fire?
[30:56:24] Wait, I don't Rape Dance a... I'm sorry. All right... Oh, fuck.
[30:57:18] I'll just cut it...
[30:57:22] Hold on.
[30:57:26] Yeah, let's catch up. Hold on. Yeah, let's catch up. Hold on.
[30:57:32] Oh my God!
[30:57:35] Hold on a second. Damn, bro.
[30:57:46] They trying to take me into the real life, my nigga?
[30:57:50] Madonna, hold your fuck up bro!
[30:57:52] You gotta add your shine, my nigga.
[30:57:54] You gotta add your fucking shine, bro. Wait, so I got a question chat.
[30:58:05] Right?
[30:58:07] Oh, hell no.
[30:58:10] I just thought there get some ketchup.
[30:58:12] Fuck!
[30:59:29] I just had to get some ketchup, I said, no Yo, I need help! out ah I'm a bad day. Catch him. What do?
[30:59:34] I don't got, I don't got no...
[30:59:38] Oh my God.
[30:59:51] I'm gonna have to fucking catch up, bro. Oh my fucking god.
[31:00:53] Okay, first of all...... Man, what the fuck? boy hold on chat Oh my God.
[31:00:57] How can I fix this shit, bro? I don't know how to put that pressure on that motherfucker. I don't have alcohol bro, I'm a bum ass nigga that live in the fucking big ass crib.
[31:01:14] I don't got out of crazy how the human body...
[31:01:33] Can I put Carmex on it?
[31:01:41] No.
[31:01:45] Is it Carme that's leading it?
[31:02:40] Wait, so I just put this here and have my sock over it? Okay. so. Hey, I'm back. Yeah.
[31:02:44] Fuck.
[31:02:48] Oh fuck. Oh, fuck.
[31:02:50] What the fuck?
[31:02:56] Wash it then put it on?
[31:02:59] Bro! fuck!
[31:03:00] Why not doctors?! so Oh my god, what the fuck? Shhh, it's mad ketchup bro.
[31:03:46] It's a bunch of ketchup on my fucking... Here we go so so All right, let's go so so so So greedy!
[31:05:45] 7500!
[31:05:48] 7500 Jack!
[31:08:02] 75 75 fucking hundred. uh so I'm not sure if you can see the so The so I'm not sure if you can see the so I'm not sure if you can see the so Fuck.
[31:08:04] Fuck! Fuck, fuck, fuck, fuck, fuck, fuck. fuck so so so so so so so so so I'm not sure if you can see the so so so so I'm not sure if you can see this, but the game is actually pretty much a I gotta attack though, right?
[31:11:11] I gotta attack.
[31:11:13] I gotta attack.
[31:11:15] Oh, he actually continued to be patient.
[31:11:19] I don't know. I don't know.
[31:11:27] She attacked?
[31:12:05] Yeah, she did. She attacked? No! so so I'm not sure if this is the best way to do it, but I think you can just go with what's in your inventory.
[31:13:33] I don't know why they're doing that here... so so so so so I'm not sure if you can see the so What the fuck?
[31:13:37] What the fuck? What the fuck?
[31:13:41] What the fuck?
[31:13:47] What the fuck? Now that, that thorny shit is good as fuck though.
[31:13:50] The Thorny chat? Good as fuck. uh uh so so so Thanks for watching! so I'm not sure if you can see the so so so so so so so so so so so so Yeah!
[31:17:42] I'm claiming your ass
[31:17:46] i'm clamping you i'm here i'm here what
[31:17:52] i'm here I'M HERE! I'M HEEEEEEEERE!
[31:17:56] THAT'S ALL I NEEDED TO SEE
[31:17:58] THAT'S ALL I NEEDED TO FUCKING
[31:18:00] SEE, NIGGA
[31:18:02] THAT'S ALL I NEEDED TO SEE, BRO
[31:18:04] THAT'S ALL I NEEDED TO SEE, BRO THAT'S ALL I NEEDED TO SEE bro that's all i needed to see bro that's all i needed to see
[31:18:07] that's all i needed to see that's all i needed to fucking see, y'all.
[31:18:23] No!
[31:18:24] It's not about...
[31:18:24] Okay.
[31:18:25] It's not about being barely halfway. this is how i know you don't play elder
[31:18:30] ring this is how i know i'm exposing you this all i know is not about being halfway as long as I'm learning.
[31:18:43] Look!
[31:18:46] Y'all wanna see how I look just now?
[31:18:49] Look!
[31:18:53] This is me! Look!
[31:18:57] I ISO'd that nigga!
[31:19:02] Fuck.
[31:19:07] I was ISOing that nigga, look!
[31:19:13] ISOOOOOO
[31:19:16] ISOOOOOOOOO
[31:19:21] ISOOO AHHHH I saw! I saw!
[31:19:25] Come on, boy.
[31:19:29] Come on. Stop! I still lost the game!
[31:19:44] I still lost the game!
[31:19:48] I still lost the game, but look though.
[31:19:54] I played a lot of games. I still lost the game, but look though. I performed out there.
[31:19:56] Come here.
[31:19:57] Excuse me.
[31:19:58] Oh, stupid dummy give me the ball back.
[31:20:01] Hey, stupid step back. Hey, stupid! Step back!
[31:20:04] Tommy?!
[31:20:11] He's clamping that
[31:20:15] i was clamping him boy.. hmm. Hold on, chat, little break. Quick little break!
[31:21:20] Hold on, quick little break, my nigga.
[31:21:40] Damn damn i'm done
[31:22:37] take a little break um so I miss Kevin bro. um Call him?
[31:22:38] No, no, not.
[31:22:45] Well, I think we link it after like in a few days. Chat.
[31:22:46] Courtesy thanks for the podcasting.
[31:22:48] Hold on let me see.
[31:22:54] Today I ain't gonna lie.
[31:22:56] I wanna watch that back,
[31:22:57] I wanna watch that back,
[31:22:58] yeah,
[31:22:58] I wanna watch that back.
[31:23:00] Tonight I ain't gonna lie bro,
[31:23:01] I don't know if you're not kevin is like a good at chat kevin's a good ass mentor bro
[31:23:12] tab i want to be able to show y'all like the amount of shit that he
[31:23:15] teaches me or like give me advice
[31:23:17] on, y'all be like, damn this nigga's a
[31:23:19] cool ass nigga.
[31:23:21] Y'all know the goal is acting, bro, so
[31:23:23] you feel me? Like, you know
[31:23:25] good ass dude
[31:23:27] bro
[31:23:32] oh my god kb mama 44. kb mama 24 forever thank you so much for the 24 gifted Kbmama24, KbMamma24 forever.
[31:23:37] Thank you so much for the 24 gifted.
[31:23:38] First of all, first of all I remember you.
[31:23:41] First of all I remember you sir.
[31:23:44] First of all I remember you!
[31:23:47] I didn't forget thank Thank you so much bro
[31:23:50] Ludwig gave 10 thousand bits?
[31:23:55] Ludwig what the fuck is going on
[31:23:57] Ludwig in a motherfucking building Ludwig, what the fuck is going on? Ludwig in a motherfucking building
[31:23:59] Is Ludwig- IS LUDWIG
[31:24:01] I thought he was VIP'd
[31:24:03] He's not VIP'd
[31:24:06] Ludwig in a motherfuckin'
[31:24:08] Oh my gosh
[31:24:09] Come on bruh
[31:24:11] Now he is
[31:24:17] Yo
[31:24:17] W in the chat for motherfucking Ludwig Okay Now he is Now he is. Yo, W to the chat for motherfucking Ludwig, okay?
[31:24:20] Now he is! Now he is.
[31:24:22] W to the chat for the motherfuckin' Ludwig man
[31:24:25] Thanks for the motherfuckin' $100 man
[31:24:27] Hopefully you're enjoying your life after this game, okay?
[31:24:30] I know you're probably enjoying your life right now.
[31:24:33] All right, Cairo, what the fuck at 25?
[31:24:35] Thank you so much.
[31:24:35] Appreciate that, Gango.
[31:24:37] I think you're probably enjoying your life right now on stream.
[31:24:40] Man. I think Bobby and Johnny are in life right now and shit. But man,
[31:24:42] I wanna be out there soon bro
[31:24:44] I wanna be on that field soon bro Let's see how we did, chat.
[31:24:55] Let's see how we do it.
[31:24:58] Let's see how you did bro. oh yeah oh my gosh
[31:25:58] no patience no patience so so Oh shit. Oh shit!
[31:26:04] Yeah, Spacey's locked in.
[31:26:06] Oh shit!
[31:26:12] Oh shit!
[31:26:30] Oh shit. Oh, dodges. Not a bad one.
[31:26:36] Fuck it.
[31:26:38] Good shit.
[31:26:40] Good shit.
[31:26:45] Good dodges, KC.
[31:26:49] Good shit.
[31:26:58] Good shit. Good shit.
[31:27:01] Oh shit!
[31:27:06] Oh shit! good shit Oh
[31:27:29] Hey look Sun sun Something that I found out while playing.
[31:27:35] Look, slam don't roll until he puts his hands up wait for it wait for it now but i got hit i got hit I double-doubled early. Look.
[31:28:14] Now, you can't even see shit right here, bro, you always gotta roll one extra time bro.
[31:28:19] I love when he does that as a freebie.
[31:28:23] You should be doing 2000,000 on this nigga Chad. Jack! Yeah, we're...
[31:28:48] Yeah, our hits are low.
[31:28:54] Sensational dodges. Come on, Lowick.
[31:28:59] Come on now. Wait, but I would...
[31:29:02] Wait, but I would...
[31:29:03] I would dodge... No, chat.
[31:29:05] I would hit are low.
[31:29:09] Not really?
[31:29:10] Yes they are!
[31:29:13] We only hit it for like $1,450! $1,500! Yeah! Wait was this one better than Chris's?
[31:29:32] Hold on, hold on.
[31:29:36] Was this one better than Chris's?
[31:29:44] I think it was low key.
[31:29:49] You gotta what, you gotta what? You gotta keep hitting him to proc bleed. Yeah. oh my god
[31:30:06] okay look at this look at the show on the fucking road.
[31:30:14] Look at this fucking show on the road, man.
[31:30:21] Red Homie Thug. Like that nut shot, bitch.
[31:30:24] Rich homie does thugger in the mothball.
[31:30:27] Rich homie does thugger in the mothball.
[31:30:31] Rich gang. Got like 4,000 followers. up to live this here lifestyle This is Unbeginnin'
[31:30:53] I'm on the top of the mountain puffin' on clouds
[31:30:56] Those niggas still begannin', that nigga
[31:30:59] P5 on a Visa card
[31:31:01] Hundred bands, dollar lots, I'm fuckin' tired
[31:31:03] So I been serving great whites like I'm Philly Outro Music Even though I'm
[31:31:25] Back in my, these hours will be worth it... I'm going to try and get the gun. Why would I do that? I don't know. I'm not sure if you can see the so I'm going to have to do this again. Fuck, fuck!
[31:33:08] Come on now! Come on I feel it.
[31:33:09] I feel it.
[31:33:10] It's coming.
[31:33:13] I feel that it is coming. It's coming. I feel that it's coming.
[31:33:17] It's coming.
[31:33:20] Oh, god!
[31:33:22] Ah! so so so so so Bad, bad run.
[31:34:23] Very bad one.
[31:34:25] Very bad one
[31:34:33] that was not on very very bad bedroom uh so I'm not sure if you can see the so so so so Knockin'.
[31:36:07] Knockin'.
[31:36:08] Now I'm mad.
[31:36:09] Now I'm mad.
[31:36:10] Watch this.
[31:36:12] Now I'm mad. uh so so so so so so so I'm not sure if you can see the so so so I'm going to try and get the I can't attack!
[31:38:49] I can't attack, I can't attack.
[31:38:52] I might have to to roll towards him.
[31:38:55] Holy shit, what?
[31:39:02] Come on, Sway!
[31:39:02] Come on, Sway!
[31:39:51] Yeah, I got to roll closer to him, I'm not gonna lie. Hello. Hello? I'm not sure if you here. What was that? Chubbo Stomp? Bro, I know I should be bro but...
[31:42:03] I don't know how to fucking do it. so so so Again! so uh I'm not sure if you can see the so so so so Oh, shit. Man! What the fuck?
[31:42:05] Man that's some bullshit bro Man, what the fuck?
[31:42:08] Man that's some bullshit bro. Hey bruh that's some fucking bullshit bro.
[31:42:12] Man what the fuck was that bro?
[31:42:15] How much did I hit him for? What's the most I had to put in that first phase
[31:42:18] it's like eight was that 8 9 I think 9!
[31:42:30] I had it for a 9.5
[31:42:34] WTF Oh shit so so so so so so so so I promise you, a thousand year voyage guided by compassion patience patience
[31:44:23] now Now! so so so so Okay, forward, forward, forward.
[31:45:26] Forward on that! Forward on that, forward on that, forward on that.
[31:45:30] Forward on that, forward on that, forward on that, forward on that.
[31:45:33] Okay? I got it, I got it, I got it.
[31:45:35] I got it, I got it, I got it.
[31:45:37] I got it, I got it, I got it.
[31:45:39] Forward on that. That's all I need to know
[31:45:46] I gotta punish. I know I know I know I know, I know. The only thing is he not...
[31:45:50] Son of a y'all boys!
[31:49:02] Fuck Fuck. so I'm not sure if you can see the so so so I'm not sure if you can see the so so so so so I'm not sure if you can see the so so I'm not sure if you can see the so Let's go!
[31:49:09] Let's go, let's go, let's go, let's go.
[31:50:38] I just need to have more flask there bro. No risky, but let's try it. I'm not sure if you can see the so so so Too late! I'm gonna go to bed. I'm gonna go to bed.
[31:50:42] Niggas said, I've been watching since 9am today
[31:50:44] you definitely improved Yo, what the fuck? so uh so so so so so so He always hit me with that he oh, he's always giving
[31:52:40] He always give you a dash in like always
[31:53:53] Again with that like always again so so so so Go! God is good! Come on now, come on bro. so so so so so I'm not sure if you can see the so Oh, my God. I'm not sure if you can see it, but the. Roll right on what?
[31:56:01] Wait, roll right on what?
[31:56:04] I don't know what that move was. was I'm gonna hit her with no flash? so so so I should be able to dodge, but how do you know that coming though and so in a moment like
[31:57:26] that in the moment like that me up right there bro so uh so so I'm not sure if you can see the so Thanks for watching! so so so so so Why do I always sell?
[31:59:48] Why do I always fucking sell?
[31:59:55] But why do i sell?
[32:00:00] Like, I know what I gotta do it's just like damn so I'm not sure if you can see the so so oh so so so so Thanks for watching! I promise you, a thousand year voyage guided by compassion the does that even mean so I'm not sure if this is the best way to do it, but I think you can get a lot of damage out of that.
[32:02:34] You don't have to be too careful with your attacks though.
[32:02:39] The only thing I'd say about this game is that it's pretty easy to get hit by these enemies. Jack, even if I don't be him today, like tonight or this morning.
[32:02:57] I just wanna la-la-la-la-la-la-la-la-la-la-la-la-la-la-la-la-la-la You feel me? so so so so so I'm not sure if you can see the so so so I
[32:05:02] Got a job on that I have to jump bro! so so so so so so so so so so Is that one new?
[32:07:11] Is that one new?
[32:07:18] What the fuck did he do just now?
[32:07:21] Yo, clip and save. Clip and save. Yo, my check, my check, my check. Clip and save that before I go to bed.
[32:07:32] Yes, that's new. He lives around that health. Oh fuck!
[32:07:33] What the fuck is that?
[32:07:34] How do you dodge it?
[32:07:35] Spam mode probably huh?
[32:07:37] Good enough health?
[32:07:40] We got a little bit of an issue here. They're in more poly huh? But enough health?
[32:07:44] Wait...
[32:07:47] Yo Mods, remind me okay?
[32:07:50] Okay let's see what y'all got. What do y'all gotta remind me when I beat this?
[32:07:53] What do y'all gotta remind me?
[32:07:58] Okay.
[32:08:02] Okay, look. And remind me too when I beat it to show y'all what I got in that package.
[32:08:09] Show you all what I have in that package.
[32:08:13] It's a big ass announcement. out what I have in that package.
[32:08:16] All right, it's a big ass announcement.
[32:08:20] Like it's like, it's a big ass announcement.
[32:08:22] All right. Signed came into the package. all right
[32:08:28] sign came in the package bro and i can't show it
[32:08:59] big big announcement. You got it, Papi! You got it, Papi!
[32:09:03] You got it poppy
[32:10:01] ampx fortnite so so I'm not sure if you can see the so Fuck. Yo, Swip! I said yo, Swip.
[32:10:03] Oh my god, it's time to go to sleep.
[32:10:05] Yo, Sway!
[32:10:09] Yo, Sway!
[32:10:14] Yo, Sway would you um...
[32:10:21] Yo, Sway would you uh play in like an outer ring tournament that i put together pin what he says I don't think he's watching.
[32:10:40] He says yes? Oh shit! oh so so so so so so so I promise you, a thousand year voyage guided by compassion. so so so so so Oh my god. Oh
[32:13:37] My lord, oh my
[32:13:43] I'll play and destroy everyone
[32:13:45] FACE PLAY!
[32:13:48] Versus let me solo her
[32:13:51] Awwww shit
[32:14:09] Awww Fuck you uh I don't want to use it.
[32:14:13] I didn't bleed! Fuck! fuck so I didn't bleed! oh
[32:14:59] ah fuck Ah, fuck!
[32:15:11] Yo, you can't even bleed in like phase two or nothing.
[32:16:15] Oh! so so I'm not sure if you can see the Fuck! Fuck, fuck, fuck, fuck, fuck, fuck, fuck, fuck, fuck. so so so so so so so I'm not sure if you can see it, but the so I'm not sure if you can see the so so I think you can't follow me
[32:19:00] i thought you said you couldn't follow me bro I'm not sure if you can see this, but the game is actually pretty much a so so so so so oh Fuck!
[32:23:57] Fuck. so so so so I'm not sure if you can see the so so so so so so so so so so so so so Fight!
[32:23:59] Oh my gosh!
[32:24:01] Oh my gosh!
[32:24:39] Oh my gosh! Oh my gosh! He bled. I made him bleed!
[32:24:50] I made him bleed!
[32:25:42] I made him bleed! Oh my god! Hold on, chat. Hold on, Chad. so so so so Oh, sorry. again oh my god it's good so That was my best one bro I'm not sure if this is the best way to do it, but I think you can get a lot of damage out of that.
[32:27:54] I don't know what's going on here... so What?
[32:28:21] What? so so Bad run! so oh That one. so so so so so so so I think on that one he got like limited range when he pounces out.
[32:31:13] So, I could be rolling backwards and then on that final beam
[32:31:18] I gotta make a left.
[32:31:20] Or I could run!
[32:31:22] I could run!
[32:31:24] Can't I? run towards him
[32:31:34] towards him um I'm not sure if you can see the Like that's sloppy.
[32:32:20] That's sloppy bro.
[32:32:22] Why am I doing like five minutes?
[32:34:52] That doesn't stop yet. I should be getting that bro uh so so so so so so I'm not sure if you can see the so so No! Test. Test! Test! so so so so so so so so I don't know how to beat that nigga.
[32:36:43] I don't know how to get him on that bro,
[32:36:46] I don't know how to get him on that.
[32:37:45] I don't know how to get him on that chair. so so so One more.
[32:37:53] A nigga should have some dignity bro, go to sleep!
[32:38:04] I want one more good run!
[32:38:13] I'm sorry guys, imma beat it right here chat.
[32:38:17] It's been real W fucking DLC, I'm about to beat it right now.
[32:38:21] Here we go! so so so so I'm not sure if you can see it, but the so so so so so so so so I promise you, a thousand year voyage guided by compassion. so God damn, chat.
[32:41:37] Clap it up for today, man.
[32:41:42] W Learning Day! Like W Learning Day!
[32:41:46] W fucking learning day, dude.
[32:41:56] That'll be learning day bro like actually bro
[32:42:01] Wait did they unlock the reddit? Did they get to unlock the Reddit?
[32:42:02] Did they get to unlock the Reddit, bro?
[32:42:08] Top. Today. Hey, top. today
[32:42:11] hey top
[32:42:13] oh shit look
[32:42:15] oh shit chat look
[32:42:17] hold on what's in the motherfucking
[32:42:20] reddit real quick y'all
[32:42:21] yeah Hold on, listen to the motherfucking Reddit real quick, y'all.
[32:42:27] Bro, why my shit...
[32:42:34] Bro, why my shit be moving like...
[32:42:41] Is there a reason why my camera moves exactly at certain positions? Like, that shit's so weird.
[32:42:46] Hold on.
[32:42:55] Hold shift.
[32:42:58] Nothing.
[32:43:00] Nothing happens.
[32:43:02] Let's see this motherfucking ready chat
[32:43:07] Five out of six and a be members still kind of rare
[32:43:11] Chat let me see if I know y'all shit
[32:43:15] What what day is the only day that you'll probably see six members live?
[32:43:23] Indeed.
[32:43:24] Oh no, A&P night, yeah. And of indeed oh no amp night yeah and if on fourth of july
[32:43:31] we literally in the club and this girl watching kai it's a problem Kai.
[32:43:45] Yo! Real one. No!
[32:43:48] It's a problem when I do it. Real one, can't miss it.
[32:43:50] You can't miss it, you can't miss it,
[32:43:52] you can't miss it.
[32:43:54] It's the real one.
[32:43:58] But why don't we show you something, look. This my comfy bag, this is my comfy bag
[32:44:00] I didn't even wanna watch this shit
[32:44:02] He fucked up my bed, I know
[32:44:04] Jctiktok editor done switched teams
[32:44:11] But why my I so slow chat
[32:44:20] hold on let me go to my task manager real quick. My shit might be...
[32:44:22] starting to like
[32:44:24] Nah, Alderic is not open
[32:44:28] Hold on.
[32:44:52] We made sure all my shit is closed. oh my gosh you know what happened when it started doing this, right chat? The last time
[32:44:56] Oh my god. Okay um
[32:45:01] What was that?
[32:45:02] Oh, Reddit.
[32:45:02] Reddit, Reddit.
[32:45:07] Bro, there's no way this is like a good PC, bro.
[32:45:10] There's no way
[32:45:11] this shit's a good PC.
[32:45:12] Like, what the fuck?
[32:45:14] Bro there's no way bro!
[32:45:20] Hopefully when I get to dance battle you. Every time we defeated a boss,
[32:45:24] You called my phone and made fun of me!
[32:45:27] In front of thousands of people!
[32:45:30] IN FRONT OF THOUSANDS OF PEOPLE JINXY!
[32:45:33] YOU ARE NOW... A F***ING QUITTER! thousands of people, Jinxy. You are now a f***ing quitter.
[32:45:35] You're a f****** quitter!
[32:45:37] Hey, Jinx you're a f****** quitter!
[32:45:39] I don't want to see you return back
[32:45:40] to the realms out for again!
[32:45:42] And that's coming from Lord Figger you know what the that said
[32:45:45] you quitter don't you ever disrespect a game like this
[32:45:48] i'm just thinking so easy to get around so easily
[32:45:51] don't you ever do that oh uh Oh shit, that's fire!
[32:46:23] What do you make Phantom as a black business queen?
[32:46:26] Oh my god. as a black business queen.
[32:46:29] Oh my god, I thought that was a... Yo, yo.
[32:46:32] You're back!
[32:46:34] What's going on?
[32:46:36] No.
[32:46:38] Is it? Hey! What's going on? No.
[32:46:42] The fuck?
[32:46:48] What do you want me to do? We challenge for now, man.
[32:46:49] But that's a girl.
[32:46:50] Nigga, fuck him up.
[32:46:51] Yo, I ain't gonna lie.
[32:46:52] My headband with the fitted combos be tough.
[32:46:56] Aon must be stopped.
[32:47:00] I'm kinda...
[32:47:02] Comfy nigga
[32:47:09] What the fuck? How do niggas even do that?
[32:47:23] They did one with me and Max.
[32:47:29] Yo, Razor like Stitch.
[32:47:33] There's a reason Khan is so happy all the time.
[32:47:36] Oh I thought you suck it out.
[32:47:39] I got a good throw.
[32:47:41] Now your trying.
[32:47:42] Now you're trying.
[32:47:42] I can suck.
[32:47:43] No, okay.
[32:47:45] They don't doubt you.
[32:47:47] There's a reason Ty is so happy all the time. I think I'm sucking off everyone in the house, buddy.
[32:48:00] Hey, if it was going to be someone in a house,
[32:48:01] then be agent.
[32:48:03] All right, you ready for this... Hey, if it was gonna be someone in the house then B-Agent.
[32:48:06] Alright, you ready for this uh...
[32:48:10] What the fuck is wrong with Jinxy bruh? Khalil is wild for this.
[32:48:12] Let me get a chance at you you know
[32:48:13] you're gonna love a tourist we're going to see well you know what
[32:48:16] jenna jackson is a tourist so i might love it
[32:48:18] that's what i'm saying you might love it but i'm not gonna hold you up too long
[32:48:21] because i don't want to make you seem like i don't want to make you seem like... I don't wanna make myself...
[32:48:25] Who said Jinxy?
[32:48:29] Huh?
[32:48:33] Wait!
[32:48:38] Oh my- I gotta go to sleep. I gotta go to sleep, I gotta go to sleep
[32:48:41] I gotta go to sleeeep
[32:48:43] I gotta go to sleep, I gotta go to sleep
[32:48:45] Seem boring to you.
[32:48:45] No, yeah.
[32:48:46] Don't be mad.
[32:48:47] But I appreciate the stuff and vibe.
[32:48:48] I have to go to sleep.
[32:48:50] Jeffrey Dahmer?
[32:48:51] Boys.
[32:48:53] Next.
[32:48:53] That's what I'm saying.
[32:48:54] But listen,
[32:48:55] why can't
[32:48:56] eat your insides? What? Let me eat you out I'm saying listen why can't watch each in size
[32:49:07] Yo What the fuck, my nigga? Bro, get this nigga off the sites, my nigga.
[32:49:09] Yo, ban his nigga's account.
[32:49:11] Yo, bro, I'm not playing with this nigga.
[32:49:13] What the fuck are you talking about, bro?
[32:49:14] You look dumb!
[32:49:33] What the fuck? Bro, what the fuck? Don't do your job! I said next, right? Do your job. Oh shit!
[32:49:35] Damn don't do your job!
[32:49:37] Nah that's crazy.
[32:49:39] Bro's coming
[32:49:40] crazy.
[32:49:41] I don't know.
[32:49:44] Wait, was that an E-date? Nah, niggas.
[32:49:55] Nah.
[32:49:56] He didn't try to say anything to win.
[32:50:00] I'll just decide. I'll just decide. All right, all right. I'll just try,
[32:50:01] I'll just try.
[32:50:01] All right,
[32:50:01] hold on a second.
[32:50:02] Hold on a second.
[32:50:03] Yeah.
[32:50:05] She mine.
[32:50:06] It don't look like it.
[32:50:08] You know what I'm saying?
[32:50:08] It really don't look like it.
[32:50:09] Look,
[32:50:09] look,
[32:50:10] look.
[32:50:11] What?
[32:50:12] Bro, what's up?
[32:50:13] She got my hands and shit.
[32:50:14] She massage me doing your dance moves and shit.
[32:50:15] Yeah, that's it.
[32:50:16] You know what I'm saying?
[32:50:17] We just ain't gotta do that anytime.
[32:50:18] You know what I'm saying?
[32:50:19] Alright.
[32:50:20] She got my hands and shit.
[32:50:21] She gonna be massaging me doing your dance moves and shit. Yeah, that's it, you know what I'm saying?
[32:50:23] She mine. I know she mine.
[32:50:25] I aint got to be all alone the whole time
[32:50:28] Yo Shine can i talk to you for a minute?
[32:50:30] You know you could be honest man
[32:50:32] Feelin' it? What's on your mind? You know you can be honest, man. Feel me?
[32:50:32] That's what I'm saying.
[32:50:35] What the fuck? What?
[32:50:38] How do you want something to buy?
[32:50:40] How did you try to get involved?
[32:50:41] How did you try to come out?
[32:50:43] We don't even ask you to love.
[32:50:46] The Ark is on the way.
[32:50:49] Hey, hey, hey,
[32:50:51] don't even say no more, my nigga.
[32:50:53] The Ark is on the way hey look
[32:50:57] i'm telling you bruh that yes the glow the glow arc of kc3 my aura is about to increase chat okay remember my face
[32:51:09] remember me all right i'm gonna show y'all something bro all right all right like real shit.
[32:51:24] Oh my god, I hate this nigga man!
[32:51:27] Coyotes are coming to Puerto Rico?
[32:51:28] I've been.
[32:51:30] You're rage for a reason?
[32:51:35] I'll put my camera on this side
[32:51:38] Yeah Raze, Raze let it out
[32:51:40] Let it out
[32:51:42] Let it out
[32:51:44] Let it out
[32:51:46] Let it out. Let it out.
[32:51:47] Let it out, let it out!
[32:51:49] Yes, let it out.
[32:51:51] Let it out.
[32:51:53] Yeah, let it out!
[32:51:55] Get mad.
[32:51:58] Yes... Ooh yes
[32:51:59] Get mad
[32:52:00] Yep
[32:52:03] Yeah
[32:52:06] Yeah
[32:52:07] Yeah Yeah. YEAH!
[32:52:09] YEAH!
[32:52:13] YEAH!
[32:52:17] Yup.
[32:52:20] Yup, yup... This keyboard is just broken bro. Just keep unplugging and fucking... Yup yup
[32:52:24] Yes
[32:52:30] Oh shit AHHHHH! OOOOOOOOH! OH SHIT!
[32:52:32] OH SHIT!
[32:52:34] AH!
[32:52:36] UGH!
[32:52:43] Pfft Yes.
[32:52:45] Yes.
[32:52:47] Yes.
[32:52:52] That was fire. Phantoms went the best so far. So he call me cuzzy, the other one thinks he blunt
[32:53:01] So he call me buzzer
[32:53:02] I always find a way to make out how life from alone
[32:53:04] Like sometimes shit go left but I can't always make it go right
[32:53:07] It's rap and shit is fun and I could do this shit just all night
[32:53:09] Like career is prime, I could never have a off night
[32:53:12] Damn!
[32:53:14] Pass me my high bad drip
[32:53:15] And my lips is always ashy
[32:53:17] I do that tough
[32:53:18] So my stance is always saggy
[32:53:19] Some call me Zeddy
[32:53:20] But the girls call me
[32:53:21] Saddy
[32:53:22] Damn! I guess that wasn't classy high bad grade so
[32:53:25] the teacher went past me high five girls with the main one was ashley her face wasn't there
[32:53:30] but at least she had to chatty could've played golf like Tiger Woods but I never learned
[32:53:33] I shoulda have a center, mama
[32:53:34] Imma wait my turn
[32:53:36] Corey Usher right in on his feet
[32:53:37] I'mma let it burn
[32:53:38] Friend of Aaron with him
[32:53:39] Bucks are bold
[32:53:40] They gon' call him Ernst
[32:53:41] Sonny made our only fans
[32:53:42] You know I'm your only fan
[32:53:43] Sonny quit her job so I guess this is her only plan
[32:53:46] You alone sittin' in the sun and that's a lonely tan
[32:53:48] You know I'm not comin' over there cause I don't fuck with sand
[32:53:50] Damn!
[32:53:52] I'm a cool person
[32:53:53] I run for the pool when we lay down I'm a cool person. I don't want to be laid out.
[32:53:57] I was chatting.
[32:53:58] What the fuck?
[32:54:01] No, we do not need a mama's in that
[32:54:03] emo brah nigga had a three second choke y'all get mama's than that
[32:54:09] enough yeah okay and it is weird always remember that
[32:54:14] had a three second stroke.
[32:54:17] Just give me my money!
[32:54:20] Just gimme my money!
[32:54:24] Just g me my money
[32:54:36] flight and castle the smartest individuals ever.
[32:54:38] How many zeros are in a million?
[32:54:42] Six.
[32:54:46] Eight. It's 8!
[32:54:49] That is incorrect.
[32:54:51] 7
[32:54:53] Bro, the bat's like
[32:54:55] 9
[32:55:16] I cash what the fuck are you wearing my nigga boy Boy! I can't breathe.
[32:55:21] No, stop playing with me! Bro, 10. Stop playing bro!
[32:55:23] It's either 8 or 10, I'm not buying it.
[32:55:25] 1 million!
[32:55:27] One million is 8 or 10.
[32:55:29] 6. Look at it, write it
[32:55:32] See it?
[32:55:34] Bro there's no way
[32:55:38] Bro what the fuck
[32:55:42] Fush fush oh wait what Bro, what the fuck? Push, push.
[32:55:43] Oh wait, what?
[32:55:44] Where do you find one of these? I need it.
[32:55:59] When you leave here, go back in that dorm, grab the first nigga you seen and beat the fuck out of that
[32:56:03] nigga till they grab you off their neck.
[32:56:06] You hear me? Show them who the fuck you is, nigga!
[32:56:10] Now look at this nigga's face man! Fuck!
[32:56:13] Show them who the fuck you is.
[32:56:14] Any nigga that motherfucking try, yo beat the fuck out them niggas.
[32:56:19] Show the fuck you is.
[32:56:21] Son of a...
[32:56:26] Yo what the fuck? The thin line between crashing down and staying positive.
[32:56:29] Fuck my life!
[32:56:38] It's definitely not though bro There's definitely progress
[32:56:40] From yesterday
[32:56:41] Oh my fucking gosh
[32:56:43] Tattooskin Huh fucking gosh from yesterday tattoo skin huh no
[32:56:51] no
[32:56:53] NO
[32:56:59] No NO! Oh, it's just his skin.
[32:57:01] Holy shit I thought he was actually gonna...
[32:57:03] holy... K-Dot should've been in the music video
[32:57:05] for that night cuz. Holy, K-Dawg's shooting a music video and nothing like us.
[32:57:13] Oh my God, this shit might be numbers man. They not gonna tell!
[32:57:14] They not gonna tell!
[32:57:15] They not gonna tell!
[32:57:17] Pick up, pick up, get your straight pockets n***a. is is I ain't gonna lie bro, around that time when they was dropping back and forth, that shit crazy
[32:57:57] boy potentially by sso freshman class, I think
[32:58:01] SXL should get constant anniversary
[32:58:03] to host and have them help with creative
[32:58:05] direction. Fuck no we gonna just keep doing our thing
[32:58:09] Best mesmer in 30 seconds beat mesmer at 30 seconds cap cap cat katanas. 18,000?
[32:58:45] That was good.
[32:58:50] It's a free heal, why not?
[32:59:05] 22,000?
[32:59:13] What?! How is that even possible? Yeah. That's how the blanket look dumbass.
[32:59:18] Did you see that dude cut off his dreads?
[32:59:23] Oh! This is my fucking life when I seen that shit.
[32:59:25] All of a fuck all my life I fuckin' life when I seen that shit. I don't give a fuck.
[32:59:26] All my life I was geeked as fuck when I see that.
[32:59:28] Where is that picture bro?
[32:59:29] Hold on.
[32:59:30] Duke...
[32:59:31] Dennis...
[32:59:32] On Twitter?
[32:59:35] Oh, there it is. I forgot.
[32:59:44] Okay.
[32:59:46] Wait, why do he block him?
[32:59:49] The way
[32:59:50] he was reading them, bruh.
[32:59:52] Multiple people beforehand
[32:59:54] are like this shit getting shot up.
[32:59:56] Man, they gonna shoot the water out of
[32:59:58] the pool i'm staying home don't show up if you like living
[33:00:03] this is what people are saying a week ago there's nothing positive
[33:00:07] they finna spray it up, watch.
[33:00:09] Nah!
[33:00:10] I am good.
[33:00:13] Nah!
[33:00:14] Don't get popped. These are all the top comments
[33:00:17] from a week ago this wild wait why does it say
[33:00:23] weak i don't know if this person edited their comment did they end their comment
[33:00:28] yeah you finna get shot up.
[33:00:29] Nah!
[33:00:31] I wanna see the aftermath.
[33:00:35] Bro is going to get shot up.
[33:00:38] This won't be safe.
[33:00:44] Ops gonna pop out security gonna be extra tight they're going to check people ear holes oh you can edit comments wouldn't it have said edit it out?
[33:00:53] Dude take me Mo man you're fast
[33:00:55] Unclench your lips like that
[33:00:58] You're fast
[33:01:00] RJ!
[33:01:02] Does anyone know Kai's mic settings?
[33:01:04] Wait why?!
[33:01:08] Al Summers but this shit not easy
[33:01:13] Bro what the fuck do you have on?
[33:01:21] Shit, what the fuck does he have on?
[33:01:33] What?! What?
[33:01:44] WHAT?! What?
[33:01:53] Kill him!
[33:02:20] Kill him! kill me uh Do you play with sweetie?
[33:02:21] Amanda.
[33:02:25] Who are you?
[33:02:28] I'm Amanda. I'm six.
[33:02:33] But we're friends though...
[33:02:36] What? We're friends though.
[33:02:38] Yo, come on!
[33:02:42] We're friends though Okay, let's go figure out why the guys popped their balloons.
[33:03:04] Why did you pop your balloon today?
[33:03:06] I just took three steps and I don't like people that are actually like her
[33:03:09] like two extra okay okay thank you um why did you just pop your balloon
[33:03:16] i don't lie when my girls talk to other guys
[33:03:18] like that was just too friendly i don't like that i'm sorry you said hey next oh
[33:03:25] well let's go see what else we have yeah this is facts why did you pop your balloons
[33:03:29] there's always one negative he ain't gonna pop the watch.
[33:03:32] I'm not looking at the balloons, they sorta look just like you
[33:03:34] Just expanding big
[33:03:36] I don't want that in my life
[33:03:38] Nigga
[33:03:40] You're. Thank you. Let's go see what else we have.
[33:03:43] You really think you can say that? That's cool.
[33:03:48] Why did you pop your balloon today? She got eyes and she can see other people dudes i can't have
[33:03:55] that okay okay look at his feet look at at his feet! There's still hope.
[33:04:10] So when she was over there, I thought she was taller than me.
[33:04:11] But it sounds great.
[33:04:13] I like my women taller than me and her legs straight she probably might walk out my life
[33:04:17] and i can't go for that wow okay no luck today but you know maybe next time. Thanks for joining us.
[33:04:28] Next up we have Miriam J welcome.
[33:04:32] Yo! That shit sound like gunshots, boy.
[33:04:37] The fuck?
[33:04:45] You know Chad, you know!
[33:04:51] Chat when I say TT
[33:04:54] you say s TT
[33:05:11] It was crazy so you wanna know what's crazy?
[33:05:31] I'm gonna show you what was pretty right now boy
[33:05:37] hello
[33:05:54] I can't even show you how it's crazy, I don't know what's crazy. NOOOOOOOOOOOOO!!!
[33:05:59] I'm gonna show y'all what's crazy.
[33:06:02] I posted this...
[33:06:04] Uh...
[33:06:07] I posted this...
[33:06:12] A whole day ago Two days ago my nigga
[33:06:30] Two. just pour like an oh the Kyne's having such a good success, he about to be on this shit for at least another day.
[33:06:37] Fuck you so did he kill it? Let's go. Don't even follow him and he still gets and i still get spoiled damn
[33:06:48] i feel bad my fault i gotta start there for god i got us oh my god i gotta stop ah i gotta start treating video
[33:06:57] games like movies is that my fault chat that might have been my fault
[33:07:04] not true gamers been my fault. Nah, nah, nah, nah, nah.
[33:07:05] Nah, true gamers?
[33:07:07] Nah, nah, nah. Niggas care
[33:07:09] because true gamers like dead ass don't want
[33:07:11] to get spoiled. That's like a nigga
[33:07:12] posting like say I'll be playing That's like a nigga posting, Like say...
[33:07:16] We playing Spiderman?
[33:07:18] It's like a niggas posting
[33:07:20] Aight y'all we find the last nigga
[33:07:22] Venom
[33:07:24] And nobody knew, you know?
[33:07:27] I was like damn nigga!
[33:07:29] Who just told niggas that Venom is in the game?
[33:07:38] I can't wait for another fun game to come out.
[33:07:40] Hold on, Sonny did you send it in DMs?
[33:07:44] L spoiler
[33:07:46] Yeah nigga he's in the game, bitch.
[33:07:48] What the fuck is he talking about?
[33:07:49] Play the fucking game.
[33:07:54] Where's that? Yo, where's that?
[33:07:59] Where is it at?
[33:08:07] You didn't send another DM. You didn't send another DM. you listen to the dms. Oh, yes he did.
[33:08:35] Lacey? What about Lacey?
[33:08:41] Lacey said he's doing a marathon?
[33:08:43] Oh, no.
[33:08:43] Tell that nigga back out.
[33:08:46] Oh, hell no.
[33:08:48] Oh, hell no.
[33:08:49] Tell him back out.
[33:09:25] Tell him back out. Tell him back out send them back out on the back outside and back out. so Kai said to back out.
[33:09:42] Guys, just because I thought of an original idea to beat a game in one night and do a marathon of the game doesn't mean that you guys have to be jealous about it.
[33:09:44] Just cause i though this idea doesn't mean you guys gotta be jealous!
[33:09:48] He's so weird...
[33:09:52] He's SO stupid!
[33:09:56] You're not beating shit! Yes I am!
[33:10:00] Bro, no you're not bro.
[33:10:04] Can I skip this or no? Skip?! What?!
[33:10:06] Just watching.
[33:10:08] Just give me my money!
[33:10:10] He's not even paying attention!
[33:10:14] No... Queen Mother He just left? So you're beating Elden
[33:10:29] Yes I'm beating Elden right now
[33:10:31] Can I skip this or no
[33:10:33] Nigga pay attention
[33:10:40] So attention he's not even yes okay oh my god you
[33:10:44] guys understand i'm actually a gamer
[33:10:53] yo john no more than eight for the five gifted
[33:10:57] okay Okay.
[33:11:02] Is this nigga just like... Ooh, belly roll?
[33:11:08] What? I didn't know he was doing that Oh, they were fighting over you!
[33:11:25] What did I do?
[33:11:27] What did I do?
[33:11:32] Like look at the shit that's relatable
[33:11:34] Oh hell
[33:11:36] It's just dudes tagging each other
[33:11:38] That's lit!
[33:11:42] That shit is fucked up bro.
[33:11:44] Three sizes don't... So you know what I can't wait for bro?
[33:11:58] Boy!
[33:11:59] Smash! Boy
[33:12:07] New York
[33:12:11] Yeah I keep forgetting We have a whole New York arc Y'all keep forgetting.
[33:12:13] We have a whole New York arc to go through, bro.
[33:12:16] Y'all keep forgetting.
[33:12:18] We have a fire-ass penthouse in New York.
[33:12:21] Y'all keep forgetting, bruh.
[33:12:36] We about to have the bros on stream every single day like my family's in New York. Talil is in New York. Pooka is in New York. Dash is in New York in New York
[33:12:40] the lamb is going to
[33:12:42] New
[33:12:44] York gonna be in New York.
[33:12:46] Brianna gonna
[33:12:47] be in New
[33:12:47] York.
[33:12:48] Chris gonna
[33:12:49] be in New
[33:12:49] York.
[33:12:52] The whole
[33:12:53] gang,
[33:12:54] the whole fucking gang The whole gang!
[33:12:59] The whole fucking game, nigga.
[33:13:08] Is this a fucking L2 button? R2?!
[33:13:16] I'm losing
[33:13:19] just stepping on shit bro
[33:13:21] look glass
[33:13:22] look
[33:13:23] alright I'm not gonna lie.
[33:13:32] TTS, come on.
[33:13:34] TTS.
[33:13:37] One of my friends is dead. Leave him in the cold, put em' in a tundrum.
[33:13:41] I pulled that bitch so she come on the hundredth room
[33:13:44] I said hold on do you come to my dungeon?
[33:13:47] She said no hold on cause you got to go crazy tom sent the dungeon in an elden ring
[33:13:54] this looked like it look like a elder ting she says she want me to marry her with
[33:14:01] the ring. I said hold on
[33:14:03] the only ring I know is
[33:14:05] on my phone. When you put
[33:14:07] up and get me done, I'ma go
[33:14:09] to the car and I'm gonna drop her off home
[33:14:12] She gone say she like my body like a feeling chrome
[33:14:15] Got that chest, got the cross on my chest
[33:14:18] Like a Chrome
[33:14:20] Put up on you cause you like to answer the phone
[33:14:22] I said hold though you can't be me not a clone
[33:14:25] got the bowser,put that link in the dome
[33:14:28] got that mothafucka cuz now I'ma go
[33:14:32] I'ma put it on 1920 by 1080
[33:14:37] She said she wanna pull up and have my baby
[33:14:40] I said you not gonna be a nice lady,
[33:14:44] but don't you
[33:14:46] even fucking bug.
[33:14:48] She like, hold on Casey,
[33:14:49] where's my hug?
[33:14:50] Test test one two... is this thing on?
[33:14:57] W!
[33:15:00] Phone calling coming from fan- mmmmmmmm
[33:15:05] mmmmmmm
[33:15:07] Hello Kai, miss you my heart.
[33:15:09] JK this is Diddy come here
[33:15:11] at last Rachi. Almost finished.
[33:15:20] Almost finished. Yo, can you send money to my PayPal?
[33:15:30] At Jetty Banks.
[33:15:32] Yeah I got you.
[33:15:37] Boy slow down boy you slow down boy what
[33:15:51] hey shucks Who about to beat their meat hard as hell when he falls asleep?
[33:16:02] Radar has been bending you over all day. How do your cheeks feel?
[33:16:08] Um, first of all bitch have some respect. Second of all bitch you look like my dick
[33:16:22] i'ma do my stuff why are trollin' like a bitch? Ain't you tired? Trying to strike a chord and it's probably a minor they not like us,
[33:16:26] They not like us, they not like us, they not like us,
[33:16:29] They not like us. They not like us. They not like us.
[33:16:29] They not like us.
[33:16:34] Kinda foot pain you have is poor circulation from sitting still too long
[33:16:38] You need to move slash walk around more between plays or maybe elevate your feet but good luck on the last boss toe.
[33:16:46] Sparkling heart
[33:16:50] Please turn this down Some of y'all are annoying as fuck.
[33:16:57] Hello?
[33:17:00] Pick the candle up, find any sort, roll all. um um how are you doing that...
[33:17:57] First one to move is gay.
[33:18:17] You stupid ass, your chair is getting fucked each millisecond that it takes a fucking breath, better save it as a collection and not use it at all or you're gonna have to experience the pain of losing this chair.
[33:18:25] Yo, you told me to remind you! Could you for real put me onto a job? This is Tardonas, T-A-H-D-O-N-U-S.
[33:18:33] What?
[33:18:35] Hi Carlos and at the third Don't Ever Rap Again.
[33:18:38] Sonny can you time me out for 10 minutes so I don't need to hear this bullshit again?
[33:18:43] WHAT?!
[33:18:54] I wanna stick my tongue between your booty cheeks and just eat your midget ass till you can't stand it no more.
[33:18:56] What?
[33:18:57] I'll mount you from behind and not in your ass.
[33:19:01] Bro!
[33:19:02] KC3 the Elden Bitch
[33:19:05] WHAT?!
[33:19:22] BOOOM Sky you think your slick, we heard that fart from earlier. Please go check her butt my boy. Love from Compton gang.
[33:19:25] Shut up, Compton!
[33:19:46] Oh... Does it bus? My nigga, what makes you think You can beat the almighty Jigak at Radon?
[33:19:49] You need Jesus to finish him
[33:19:51] Yo
[33:19:51] Die well, Kai.
[33:19:59] Everyone wants to feel bad for
[33:20:01] Kai for having to kill Radon one time, but nobody feels bad
[33:20:05] that Radon has to kill Kai 300 times.
[33:20:08] Oh my gosh bro!
[33:20:11] Kai why don't you eat pussy?
[33:20:13] The girlie's not gone like that one.
[33:20:15] Now I do eat pussy but just not everybody! You feel me with my motivation? I hate that box!
[33:20:22] Hey Kai, do you know where Arden Ross has been?
[33:20:27] That's real nigga shit!
[33:20:32] Kai can we do a prayer, praying gesture?
[33:21:08] Sleep on the bed upside down. NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN E-E-E-E-Es J-K-Its P-D-B Turn around and spread them open Oyo pet pete peet peet peet peet peet peet peets
[33:21:11] Puy friend's toe
[33:21:16] Kai's neck, Kai's back. 24 hours later radar I'm still blowing his back
[33:21:21] So many deaths turned his ass to booty clapper
[33:21:24] Got the juice rollin'
[33:21:29] Hi Kai my name is Dylan. I have been a fan
[33:21:31] of you for many years and I'm shaking
[33:21:33] sending this to you right now
[33:21:35] but am truly not asking for a handout
[33:21:37] I'd what to do.
[33:21:39] I have a baby on the way due on October 15th
[33:21:41] I lost my job two months ago
[33:21:43] due to a medical condition
[33:21:45] I have me and my wife are about to get evicted
[33:21:47] I hope this isn't too much to ask,
[33:21:50] but can you help me set up a GoFundMe or something?
[33:21:56] Don't you just hate it when your cat wakes you up like
[33:21:58] this?
[33:21:59] Meow. Meow. Meow. cat wakes you up like this meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow Meow. God told me to tell you cowboy for the next few hours.
[33:23:10] My name is K I Got Manhandled by Radar and Enfemboy Miquela 3000 times senit.
[33:23:21] You're so short in person, I can literally pick you up with my big dick!
[33:23:27] You're so fun size!
[33:23:37] Hey Kai, maybe you should ask Tyler again but next time not on stream because you never know and good night gang.
[33:23:45] You are so entertaining downloaded Twitch to watch you for the first time you are adorable and so funny love youtuber hungry lips
[33:23:52] my brother is special ed and he made his own language
[33:23:54] and he wants you to say i love you which is on a homer ass went get the blunt
[33:24:03] friends blood arm it causes blood build up 206. Swoosh, swoosh, swoosh, swoosh, swoosh, swoosh.
[33:24:25] Goodnight Kai I love you my little gummy bear.
[33:24:39] Hey, Kite's radar and make sure you get some good sleep tonight little guy just remember you ain't beating me even in your dreams.
[33:24:45] Smile for the camera Kate's your mom cheeeeeeeese
[33:24:49] J-Kate's P did he turn around and spread them open orio
[33:24:53] bet peedept peedpeet peep peed peed peed pui friends now I'm bout to blow blow blow
[33:24:58] blow blow blow blow meow meow meow if you're happy and you know it.
[33:25:03] Clap those cheeks.
[33:25:07] React to Big Body by Gay Dane Harding and DaBaby.
[33:25:11] Love you gango from streamer to streamer.
[33:25:18] Bro, I'm getting married in the Philippines next year on
[33:25:21] 14th of August. Can we invite you, and would you come? That
[33:25:26] would be epic! I'll send you a DM. I'm Mark Naorne on IG thanks bro.
[33:25:38] Do you ever wake up in the morning and think how crazy your life is?
[33:25:40] Much love from New Zealand.
[33:25:42] Hell yeah!
[33:25:44] Um...
[33:25:47] I would pay a lot of money to be that toothbrush right now.
[33:25:50] Yeah, I will go to your wedding bro.
[33:25:52] I will go to your wedding bro.
[33:25:54] Hell yeah bro, I'll go to your wedding bro. Yeah bro.
[33:25:57] Can I bend over daddy and spread those cheeks in going in raw
[33:26:01] And pulling that hair daddy?
[33:26:20] Oh Maidenfiregis about you on Instagram. Guess what, in back. Kai's neck, Kai's back, 24 hours later Radar and Stay blowin' his back.
[33:26:26] He suckin on on Radhan's
[33:26:27] massive hog pack,
[33:26:29] Radon's jungle juice rollin' down
[33:26:31] his lips.
[33:26:35] Hi Kai you are one of my favorite streamer that I hope you have a good night.
[33:26:45] Kai plopperjohnly underscore, ploppah johnley Ploppazholi Ploppazhiliinj Ploppazholy Poppazholy Ploppazholy Ploppazholy Ploppazholy Ploppazholy Ploppazholy Ploppazhoajoli popajolikai I can't wait to watch you sleep.
[33:27:07] You niggers are so weird let gang sleep so we can bust Radon tomorrow.
[33:27:17] Who thinks Kai won't beat this boss and go over 1300 deaths?
[33:27:22] Ha ha ha ha ha ha ha ha ha ha ha ha ha ha.
[33:27:29] The Fitnessgram Pace-A Test a multi-stage aerobic capacity test
[33:27:34] that progressively gets more difficult...
[33:27:36] Yo, remind me to react to the baby and B.A.G. harder one
[33:27:39] when I'm eating breakfast tomorrow, Chad, alright?
[33:27:41] First thing you remind mommy to do that
[33:27:42] It's $100 stop slowly
[33:27:45] But gets faster each minute after you hear this signal
[33:27:49] Beep a single lap should be completed each time you hear this sound
[33:27:54] ding remember to run in a straight line and run as long as possible
[33:27:58] the second time you fail to complete a lap before the zone.
[33:28:05] Shit!
[33:28:06] Beat this fucking boss it gets to a point dude.
[33:28:10] I know bro...
[33:28:12] I know dude...
[33:28:16] It gets to a point.
[33:28:22] Oh chat, how was that day? Oh 77 quintillion 777 quadrillion 777 trillion 777 billion 777,777,777,777,777 sleep well.
[33:28:44] John Madden, John Madden, John Madden, John Madden
[33:28:54] Reactor John Madden
[33:28:57] React to Gio Finnebus that song is fire
[33:29:05] You need to run colossal weapons for players build up on radar and to stance break him. Sorry guy who wants Kai to go to his wedding August 14th.
[33:29:24] He will still be busy fighting Radar.
[33:29:31] They not like us, they like us here fan here fan here fan. I was talking with the wife earlier about spicing up our sex life.
[33:29:47] I asked her if could try the other hole, She replied with sorry we can't afford kids yet
[33:29:55] In the guy who wanted you to talk in my brother's language, but you had a toothbrush in your mouth may you please
[33:30:01] say it again on homer ass wet
[33:30:05] Kai by any chance have you heard the song 1990 by jie yasawa
[33:30:16] hey kai lewis here would you be down for a custom keyboard?
[33:30:21] Would love to build you one, will drop you a DM on Twitter.
[33:30:27] Kyriel shit gang you never wake up and be like damn i'm a millionaire
[33:30:44] Lil bro still made unless till this day what's it like being well done virgin ha? Ha ha ha ha ha ha. Oi friends, they're looking ass!
[33:30:46] Radon changed you.
[33:30:48] Shut the fuck up.
[33:30:50] Lil' rat said it.
[33:30:52] I went to bed twice and woke up and still you got radon stick in the back of your throat.
[33:30:56] Take it out and use your rat brain dumbass!
[33:30:59] Come to The Netherlands we will fuck them cheeks like speeds!
[33:31:03] WHAT?!
[33:31:06] I love short maggots like you spread those shakes.
[33:31:10] What?
[33:32:20] I love short maggots like you spread those shakes.. baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby baby b beep beep beep beep beep beep beep beep beep
[33:32:27] kai stream with mel btw she is a baddie and will buy you whatever you want she did it to silky and she will do you like didion fart in your
[33:32:31] mouth ty radon is waiting for you in your nightmares he's ready for you tomorrow
[33:32:44] hey kai i noticed you curious about how phase sway or the guy who beat mesmer
[33:32:49] in 30 seconds have so much damage.
[33:32:52] And it's because of Golden Vow and Flame Grant me strength buff that you can use Kai Smile!
[33:33:00] I think i could get a loan? Smiley.
[33:33:09] Hi babe, would you ever date a supporter? Why or why not?
[33:33:14] My girl gotta support me so...
[33:33:20] Don't you just hate it when your dog wakes you up like this?
[33:33:24] Woof, woof, woof, woof, woof, woof, woof, woof, woof, woof, woof, woof, woof, woof, woof, woof.
[33:33:48] Hi Kai, every time I see you
[33:33:50] I feel some type of way
[33:33:52] When I see you sleep something rises in me
[33:33:54] My cock will grow to your size one day When I see you sleep something rises in me.
[33:33:54] My cock will grow to your size one day and we will touch each other until you orgasm.
[33:34:02] Yo Kai, I am 24k median on TikTok and I post you and Duke mainly.
[33:34:07] Just wanted to appreciate you for reposting and liking my videos multiple times helps out a lot.
[33:34:18] Hi Kai, my name is dylan i'm from pennsylvania i have been a fan of you for years
[33:34:21] me and my wife had a baby on the way i lost my job due to a medical condition
[33:34:26] we also lost our car due to a medical condition we also lost our car
[33:34:27] due to accident can you help me with the gofundme or something i would truly
[33:34:32] appreciate anything
[33:34:36] hi kai can i suck you, I'm cat meow meow meow meow meow meow meow meow meow meow meow meow meow
[33:34:46] Nino yeah I am white by the way.
[33:34:57] Can you fly me out from Dubai? I wanna kick it and tax them.
[33:35:03] Tax that nigga!
[33:35:08] But we're friends, so if you move Kyogre and Diddy will come our year.
[33:35:16] Who's your dream guest? Male and female? Hope you get some good rest and shit on Raiden tomorrow.
[33:35:29] Kai can you say a prayer before we go to sleep? Prayer is a powerful way to start and end the day.
[33:35:36] God please make sure that we get a good night's sleep, and make sure that we all...
[33:35:41] Hi Kai! I'm French and we French love you.
[33:35:42] Allez les bleus vivent papay et tous les crampes sous patois? Bon appétit!
[33:35:48] Good night to bon wee mon ami American.
[33:35:58] Yo Kai can we get an up the woods please big love from New Zealand?
[33:36:14] Damn bruh! Can you hurry up and go to sleep already? Joffrey needs to make a new video.
[33:36:22] Good night, remember to pray before you go to sleep and just remember You are an amazing person and you will beat that nigger, just don't give up.
[33:36:30] Much love bro no diddy-diddy-diddy-ditch-tiddy-diddy-diddy did it
[33:36:40] at this point radon is drake and kai is the nine year old
[33:36:44] who else thinks radar has a massive hog? Things probably bigger than
[33:36:48] a Bologna stick.
[33:36:52] Hey Kai, can you react to Geofinibust on YouTube?
[33:36:57] What?!
[33:37:02] Oveho. I'm sorry.
[33:37:16] My day went so well! I recently got to acting role. How was your dear love?
[33:37:23] Dot what's in the package? It was funny the first time, but this time it's serious.
[33:37:40] Your chair is going through every types of diseases and symptoms within its last breath.
[33:37:45] I mean jeez have you seen the way you try to pick it up from the hard cement below you,
[33:37:50] It literally looks like it's about to be broken into smithereens.
[33:37:54] You need to save your chair or we will lose this legendary item and we will not
[33:37:58] be able to see it on stream ever again.
[33:38:03] Hey Kai, It's your mom smiling say cheese
[33:38:06] JK it's Raiderhund end over
[33:38:08] And let me get a good lick of that
[33:38:10] Nevermind love you bro just make sure to show your ass on camera while you sleep
[33:38:15] meow meow meow meow meow you woo wee more than friends though
[33:38:36] kevin has begun Kevin has bigger pecs than yours. Have you ever had the chance to check on speed? He is fighting for his life in The Netherlands long.
[33:38:39] I did, I did, I did!
[33:38:44] Real talk Kai,
[33:38:46] I just turned 20 and I don't want to work a 9-5 for the rest of my life
[33:38:50] How do i get good at streaming?
[33:38:57] Backing the day on the bus, I threw an empty bottle in front.
[33:38:59] It had hit one of the ratchet bitches
[33:39:01] then she stood up screaming
[33:39:03] and my mans blamed it on one of the special kids
[33:39:06] nigga was getting cussed out and he was drooling i kind of felt so bad
[33:39:13] I asked you a real question gang that's why you will never be adult type PS we're friends too.
[33:39:24] Bro, i'm serious about inviting you on our wedding in the Philippines next year.
[33:39:29] Ha ha! I know it's unlikely that you'll come but it will be an honor if you could come.
[33:39:35] Anyway, I'm sure you'll be done with raden by tomorrow kill it
[33:39:40] taxi bro react to geo and skill a baby song Badabing.
[33:39:54] Have you dreamed about Elden Ring yet with all the hours
[33:39:57] you have played.
[33:39:58] By the way, love your stream brother my son and I love watching you
[33:40:01] and got us trying to play Elden Ring together taking turns on bosses.
[33:40:06] By the way we friends though
[33:40:10] can you guys hear that helicopter at can you guys hear that helicopter
[33:40:15] and can you guys hear that helicopter? At.
[33:40:22] Kai, what if I stick my finger up your penis hole?
[33:40:26] Bro, WHAT?! What?
[33:40:37] Yo, I was wondering if you wanted to be my godfather for my confirmation sometime next year. I already sent a DM on insta it's
[33:40:42] mattyg underscore one underscore please let me know
[33:40:48] Kai can you congratulate me i legit just beat the DLC after eight hours of
[33:40:53] fighting Radon.
[33:41:00] Hi, I have a problem I can't stop saying I just can't. Itt ittt its my tic please any tips? M White
[33:41:11] Can you guys hear the helicopter?
[33:41:14] At.
[33:41:19] Oh, the cats won't stop. meow meow meow meow meow meow meow well here comes the dogs too woof
[33:41:41] meow woof meow woof meow meow Meow. Woof.
[33:42:00] Just chillin' I see Why boy I was doing it right now bro!
[33:42:09] Why boy M with the back of your hand? I am the baggagation! Oh my god, speed!
[33:42:17] And speed!
[33:42:21] A girl and a gamer? Well mama.
[33:42:23] Cummina hummina hummin' a bazooing
[33:42:25] Eyes pop out arooga.
[33:42:28] Jaw drops tongue rolls out woof woof woof woof
[33:42:36] Tongue bursts out of the mouth.
[33:42:38] Uncontrollably leaking face and everything in reach.
[33:42:41] Wobble, wobble, wobble, wobble, wobble, wobble, wobble, wobble.
[33:42:45] Tiny cupid shoots an arrow through heart army lady.
[33:42:48] Heart in the shape of a heart starts beating so hard you can see it t
[33:42:56] Radun is god, Radun is king
[33:42:58] have fun getting fucked by him in your dreams.
[33:43:01] LMAO but we friends though ha ha ha ha
[33:43:03] SHUT THE FUCK UP!
[33:43:04] B-B-B-B-B-B-B-B-B-B-B-B-B-B-B-B-B-B-B-B-B-B-B-B-B-B-B-I-I bb
[33:43:17] when radar levitates for lightning storm, run behind him so you can attack after, not away from him.
[33:43:28] Kashup is taller1.00, Adam Lewis $1234
[33:43:39] Hawk 2 ahawk2 ahawk2 ahawk hawk to a hawk to on the guy.
[33:43:48] Hello Kai, I can't wait to see you in Paris.
[33:43:52] France, France, France...
[33:43:55] Paris be on the way!
[33:44:00] Olympics!
[33:44:02] Be on the way! France OLYMPICS! BE ON THE WAYYYY
[33:44:07] FRANCE
[33:44:13] Oh shit.
[33:44:16] Good night, Shep!
[33:44:17] Hi Kai this is Dylan Mike of Shepherds Dollar Michael 011219
[33:44:21] Thank you so much truly for anything that you can help us.
[33:44:25] You are so awesome in every aspect.
[33:44:29] I said goodnight chat!
[33:44:30] Yo Kai, I ain't going to lie to yes my first bit donation but bro just saying before you truly beat the game
[33:44:37] You got to beat Bale The Dread that one dragon you ain't getting out of
[33:44:41] That my heart haha but frfr love your content
[33:44:44] Gee trying to get to TS level someday maybe even join amp god knows but love y'all chat and more
[33:44:50] Importantly Jesus loves you all
[33:44:55] Niggas really pay to send a message to ask for money. Lookin' ass niggers.
[33:45:04] Khaap is Adam Lewis 1234.
[33:45:15] Kai I got a song called Katana Goes out. Can you say we got cas amigos? Bitch put down that truly
[33:45:23] Drewski kicked me off coulda been Nelly
[33:45:27] Promised consort Radon promised consort radon promised consort radon promised consort radon promised consort radon promised
[33:45:51] consort radon promised consort radon promised consort radon promised
[33:45:56] consultant raydon promised and so trade on promised consult, radon promised consult, radon.
[33:46:03] Finish the prayer bro haha Here.
[33:46:19] Yo, Kai guess what keeping off of EZ Boss?
[33:46:29] Faze Sway defeated him like 20 times. You suck, but we friends though ass
[33:46:41] Hello this is you have 10 seconds to get out of your house.
[33:46:46] How much people does Madison Square Garden hold?! um would you consider playing any of the
[33:47:01] other souls games dark Souls 3 is worth
[33:47:04] 50!
[33:47:09] Jesus loves you all, amen?
[33:47:11] Folded hands, folded
[33:47:13] hands.
[33:47:17] Wait, look Folded hands, folded hands. Wait look it up! Look it up!
[33:47:19] Look it up! Look it up! How much does that hold?
[33:47:22] Yo-kai 24 Karat Media again
[33:47:25] You should listen to more songs during streams those clips do
[33:47:28] the best for me on tick-tock rod all owns you and blew your butt cheeks to mummy dust.
[33:47:42] Oh, fuck...
[33:47:45] Kaihai ran you a bubble bath come bring the tight little body in here.
[33:47:48] What up, what up!
[33:47:54] Would the festival be fired here?!
[33:47:57] Will KC Fest be fired here? Yeah, nigga. Boss on me.
[33:47:58] Will KC Fest be fired in Madison Square Garden?
[33:48:01] No no, Fossabot. Kind sir do not attempt to mute me.
[33:48:05] I have to inform the viewers of the extreme abuse that the chair had been going through.
[33:48:10] Please, Kai, do not break it into smithereens with your fat dwarf booty ever again!
[33:48:15] What are you called like a... Puck?
[33:48:18] It's crazy how I've never met you but feel like I'm your friend. What do you call like a park? What do you call it?
[33:48:19] It's crazy how I've never met you,
[33:48:20] but feel like I've grown such a great connection with you
[33:48:23] through just these streams.
[33:48:24] Well not a festival because a festival
[33:48:25] wants to be outside on multiple days right?
[33:48:27] Outside is crazy,
[33:48:28] but you really have helped me through tough times.
[33:48:29] Right! I don't know...
[33:48:34] Kai your streams truly give hope to those who are dealing with dark times
[33:48:38] I am an opiate addict, but I never
[33:48:40] give up on my journey to sublime.
[33:48:42] You didn't do streaming events too?
[33:48:44] Like if I had the right person, would Master Square
[33:48:46] have gone and done live streamed events like concerts?
[33:48:48] What does the BattleBots app say, MP2?
[33:48:51] They do right?
[33:48:53] Well have I got the people to do it?
[33:49:01] When will you finish life is strange.
[33:49:03] Chad I ain't gonna lie bro, I promise you bro.
[33:49:06] Chad I ain't gonna lie, I promise you
[33:49:08] I could cook up the craziest shit
[33:49:11] Tyre, I love you SM, I hope you have a good night
[33:49:22] One time I was fucking a girl from the back and my ass started clapping.
[33:49:26] I had to stop and adjust.
[33:49:28] I might just do that shit on my birthday!
[33:49:32] Stop acting like you have hoes in your phone texting you. Put it away and let me start sucking your toes.
[33:49:41] Golden Vow and Flame grant me strength as a spell buff that you can use with the seal
[33:49:47] card and just swap it out after you use it.
[33:49:50] What give insane damage but some steps...with seppuku well.
[33:49:55] Probably September!
[33:49:57] September might be better.
[33:49:59] Hey love, just in case you haven't heard it lately
[33:50:03] Keep being you man
[33:50:05] You make mine and also other people's day Just being your authentic self I'm gonna make a list, I wanna make a list! Hold on.
[33:50:17] Can I have a clothing brand called Last Tab on Instagram
[33:50:21] Can i send you sweatpants?
[33:51:07] I hear the helicopter now. shake shake shake shake shake shake shake shake shake shake shake shake shake shake okay chay what does kai do if i put my finger in your nose and then I eat your booger
[33:51:18] tonight hi thanks for all
[33:51:21] BTW one of my favorite streamers Lubius adores you
[33:51:25] You met him at MrBeast video and so I hire you
[33:51:28] Listen listen listen
[33:51:31] What was that? So I hired you. Listen, listen, listen. Listen, listen, listen.
[33:51:33] Well listen... Ken Carson
[33:51:35] Playboy Cardi
[33:51:37] Yo Kai what's up?
[33:51:38] I hope you're doing well brother!
[33:51:40] Who is your favorite DLC boss RM? Ice Spire doing well brother who's their favorite dlc boss rm
[33:51:43] ice spice hey boogie travis scott tyler lil yachty what does kai do if i put my
[33:51:50] finger in your nose and then i eat your booger
[33:52:02] under 1 000 deaths they are coming for the statue.
[33:52:11] Then go play Elden Ring, and kick Radan's ass.
[33:52:15] No true gamer can sleep when he's addicted to the food in lunch.
[33:52:22] Kai, you got this also do you? on playing other souls games after Elden Ring?
[33:52:32] Kai watch Sway's stream he has a macro to rune farm while you sleep brother
[33:52:42] Ask me like how much main adlives?
[33:52:45] You gotta be open up
[33:52:46] and it has to play.
[33:52:50] Cause how long does the average set
[33:52:52] How long does the average set
[33:53:00] Just want to take this opportunity to say everyone follow it see a boy Jared on tick-tock thank you chat your kind of library shit Fuck knows that went out
[33:53:07] Your kind of library
[33:53:08] Shit Margie
[33:53:09] You look like Donkey
[33:53:10] From Shrek
[33:53:11] Can I this my first time saying hi to you bro.
[33:53:21] But are you finna play college football 25?
[33:53:24] No ice-pies please nigga!
[33:53:27] We doing it in New York nigga it gotta be
[33:53:31] Kai if you don't betray Dan tomorrow you will never beat him
[33:53:35] Think of we friends to every time you die so you don't die. Die well, Kai!
[33:53:44] Kai what is the BattleBots XAMPP collab? Will you be there
[33:53:55] love your bro not much but it's what i got thank you for the stream
[33:54:04] With them artists how much money should I sell tickets for bro?
[33:54:09] Like it's gonna be fire again again this damn thing is going for like a hundred something again
[33:54:12] again no again no again again yeah it was like again again again again again again again Again. Again. Again.
[33:54:21] Again.
[33:54:22] Again.
[33:54:23] Again.
[33:54:24] Again.
[33:54:25] Again.
[33:54:26] What?
[33:54:27] Again.
[33:54:28] Again.
[33:54:29] Again.
[33:54:30] Again.
[33:54:31] Again. Again licking right on big fury balls.
[33:54:39] Fuck though!
[33:54:40] And there's like a lot of good people?
[33:54:42] We friends toe, we friendsstoe, we friendstoe.
[33:54:48] Uh, honey?
[33:54:52] Madison Square Garden can hold 765 quadrillion 829 trillion 405 billion 745 million 34 302 rats hundred and forty five million thirty four thousand three hundred and two
[33:55:05] racks on your side sponsors
[33:55:12] out of pocket money.
[33:55:23] So, we gotta make that shit back. Even if I break even like... I don't give a fuck. Like I break even, I break even.
[33:55:25] Let me suck it
[33:55:26] to your legs.
[33:55:27] And then
[33:55:28] some of these artists
[33:55:29] might charge
[33:55:30] or something like that.
[33:55:31] Somebody
[33:55:32] I think
[33:55:32] some of them
[33:55:33] would do
[33:55:33] an off the strict
[33:55:33] of love
[33:55:34] A lot of them
[33:55:35] that I know
[33:55:35] would do an awful love i would like to inform you that i busted a huge nut
[33:55:40] to your shot my earth shattering orgasm started
[33:55:43] making me moan loud enough to death and anyone
[33:55:46] in there me moan loud enough to death in anyone and every single thing.
[33:55:48] What followed was a torrential downpour of
[33:55:50] every single sperm cell I ever have or will
[33:55:52] ever produce, shot out so hard
[33:55:54] that it ripped my dick apart by
[33:55:56] my uber not accelerating Get off me! GET OFF ME, OH GOD!
[33:56:16] Amazon Music? No nigga that shitittin' on KC3000!
[33:56:21] What the fuck?!
[33:56:23] Why wouldn't that be shittin' on my shit?
[33:56:25] Wait, would it mean Amazon is gonna come out and have me? You look like a last part 2 incoming.
[33:56:32] Nah bro, that shit should be on my shit.
[33:56:34] That shit gotta be on my shit boy!
[33:56:36] I need all of that!
[33:56:39] That's legendary bro, we'll like the first people to do it.
[33:56:40] Can't stop my throat can't take it.
[33:56:41] Oh my fucking god.
[33:56:42] Please come in my mouth.
[33:56:43] Drop your weapon.
[33:56:44] I'm gonna make you a little bit more powerful than you think you are.
[33:56:45] You're not even gonna get away with this.
[33:56:46] You're just gonna have to go through me and then we'll see what happens.
[33:56:47] I don't know if I can handle this.
[33:56:48] I'm gonna try to kill you.
[33:56:49] I'm gonna try to kill you.
[33:56:50] I'm gonna try to kill you. I'm gonna try to kill you. I'm gonna try to kill you. Oh my fucking god.
[33:56:53] Please come in my mouth!
[33:57:16] Droplets Droplet, droplet, droplet, droplet, droplet, droplet, droplet, droplet, droplet, droplet, droplet, droplet, droplet, droplet, droplet, droplet, chocolate, chocolate, chocolate,
[33:57:21] chocolate, chocolate, chocolate, chocolate, chocolate, chocolate, chocolate, chocolate,
[33:57:26] chocolate, chocolate, chocolate, chocolate.
[33:57:29] Droplet, droplet, droplet, droplet, droplet, droplet, droplet, droplet, droplet, Droplets droplets droplets droplets droplets droplets droplets droplets droplets droplets droplets
[33:57:49] droplet droplet droplet droplet droplet droplet droplet droplet droplet dro, droplet, droplet, droplet, droplet, droplet, droplet, droplet, dro...
[33:58:02] Hey Payne developing a fantasy sports app for iPhone that allows users to get free sport jerseys and apparel.
[33:58:08] DM me if you or anyone would be interested in partnering for Stake,
[33:58:12] or everyone Venmo me $ dollar at Queninger 01.
[33:58:22] Exclamation mark hash percent plus backslash yen greater than tilde carrot equals vertical bar yen less
[33:58:29] than percent plus euro back slash exclamation mark I want to come up, bro. Check! I want...
[33:58:37] Check!
[33:58:38] I wanna come up, bro.
[33:58:39] B-B-B-B-B-B-B-B-B-B-N-M-F-N-T-K-N-P-N
[33:58:41] I wanna come to all aspects, bro.
[33:58:45] Like...
[33:58:46] We friends though, we friends though, we friends though, we friends though. We friends though. We friends though.
[33:58:57] Kai could you turn TTS off while you talking abt this then turn it in when you going to bed but yay this she annoying love u yo
[33:59:09] Kai you have that look in your eye, you want to get back on and be traitor now.
[33:59:13] You're gonna beat his ass Kai, you got this, never give up bro!
[33:59:21] Don't move in almost done. Psych I like when they squirm. I'm going to go with the
[33:59:31] Sprinkler.
[33:59:34] Kai, the sprinkler goes TSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTTTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTTSTSTSTSTSTTSTSTSTTSTSTTSTTSTTSTTSTTSTTSTTSTTSTTSTTSTTSTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT tsts yes yes yes yes yes yes yes and goes back like tttt TTTT
[33:59:55] VIP tickets for 2k Reg for 500
[33:59:57] Also you gonna take another 24 hours
[33:59:59] to kill final boss
[34:00:02] Kai I am a content creator final boss
[34:00:08] kai i am a content creator from australia called it's your boy jared on tick tock any change of the collab if you ever
[34:00:10] come to austral, worth a chance.
[34:00:16] The test results are in. Let's print them out.
[34:00:20] ... Good night, good night
[34:00:31] So I'm gonna do your motivation bro Shit crazy Shout out Saudi Arabia less than three.
[34:00:49] I said, I'm Saudi Arabia!
[34:01:01] I wanna fuck you so badly that I grab your ass and start spanking it while pushing your head on the floor doggy fucking you until you start to drool.
[34:01:05] I notice the saliva beginning to drip and grab your face, slapping it, shoving
[34:01:10] my cock inside your mouth deep-throating you in and out continuously until I cum a big
[34:01:14] assload into your mouth and make you swallow my hot creamy cum.
[34:01:18] I then get...
[34:01:22] What the fuck?
[34:01:24] Beep beep beep beep beep beep beep beep beep beep beep beep beep beep beep beep beep BPPBPBPPBPPBPPBPPBPPBPPBPP
[34:01:36] To the people who donated gay messages gets no pussy in their life.
[34:01:47] Did you clear the boss?
[34:01:50] Huh?
[34:01:58] Sunflower, sunflower, sunflower, sunflower, sunflower, sunflower, sunflower, sunflower.
[34:02:06] The ting goes scrah-ah-pac-pac caw-caw-caw caw-caw skidiki pac-pap-pa Ah. Pack, pack. Car, car, car.
[34:02:11] Caca.
[34:02:11] Skidiki.
[34:02:12] Pack, pack, pack.
[34:02:13] And a poopoo-pipoom.
[34:02:15] Boom.
[34:02:15] Skyer.
[34:02:16] Ah.
[34:02:17] Do the cootoo.
[34:02:17] Done, done.
[34:02:18] Done.
[34:02:21] Hey guys, check out C50Arm0 on Twitch, he's a good friend I love your big luscious lips and their sexy six-pack
[34:02:39] him really trying to go down you, I just know it stinks so good in trying to make down you i just know it stinks so good
[34:02:43] in trying to make sure you can't walk the next day
[34:02:46] he'll shove it so deep and so good you fall in love with me please
[34:02:50] just one chance good boy my My arm is beating! Nervous sweat, nervous sweat, nervous sweat,
[34:02:58] nervous sweat, nervous sweat, nervous sweat, nervous sweat, nervous sweat, nervous Nervous sweat. Nervous sweat. Nervous sweat.
[34:03:05] Nervous sweat. Nervous s-
[34:03:09] Can I shove your big cock in my mouth?
[34:03:17] Oh, my fucking god.
[34:03:28] Bro, do the Matri-Side quest 300 thousand frags and a katana that can't be blocked.
[34:03:38] Hey Kai remember when you said you would give me money for my birthday?
[34:03:44] Hell nah.
[34:03:48] Are you gonna MC the event and stream at the same time?
[34:03:54] Yep. I'll be there in the evening when I'm streaming perfectly
[34:04:00] What's up y'all, it's SeatDadPussy 445 again coming at you with another vid. But on god I just got done beating my shit so fucking hard that my calluses
[34:04:04] on my hand opened up again. On fucking God I'm waiting for this to become a goddamn sport bro!
[34:04:11] Anyways, I wanna meet up so I can give you a cupcake. Good night, bro. Don't know why I got timed out.
[34:04:26] I didn't write a romance novel, I just spammed a few letters. I'm telling you bro, Matrice sidequest. 300 thousand frags and a katana that can't be blocked.
[34:04:43] You not selling out Madison Square Garden, bitch-ass nigger? I'm starting a venture with my mother to donate more to Kai. Help us reach 1000 followers on Facebook to buy the verification, thanks! Thanks.
[34:05:24] Kai, why did you get friendzoned? You a hoe ass bitch ass nigga fuck you. Fuck you, bitch.
[34:05:28] Does anyone have any one advice on how to
[34:05:32] beat my shit? Snowflake, snowflake,
[34:05:34] snowflake,
[34:05:36] snowflake,
[34:05:38] snowflake,
[34:05:40] snowflake.
[34:05:45] Can I work together Snowflake, snowflake. Kai I want to grab you by your waist and slowly bring you in
[34:05:49] feeling your soft body against mine
[34:05:51] ill grip on all the love handles i can
[34:05:54] as i stroke her she from the back and watch you quiver from pleasure while I hear you whisper daddy.
[34:06:00] He'll make you cream everywhere I can, be a good boy and let it happen, I can make-
[34:06:28] Okay... good boy and let it happen. I can make... Hi who is that behind you statue? He was just behind you. It was a mischievous tall hat man bro, but was scary as hell.
[34:06:44] Tickets should be 300 apiece. Bitch fuck you and fuck your grandmother's Facebook. And to the dumbass that spammed Snowflake literally shut the fuck up on God.
[34:06:49] I'm busy trying to stroke my shit right now on Godgang.
[34:06:57] Haida Veda is getting married in Nigeria right now.
[34:07:05] Congrats on the Vito!
[34:07:07] I love you, Kai Daddy. You make me so horny.
[34:07:11] I love you so much please fuck my pussy and slurpy
[34:07:15] My juicy cock while I finger you butt sucking your toes
[34:07:24] First grunt to say 7 in the chat after this TTS pops up gets a gifted sub.
[34:07:35] Hi K, Edie spat, Shuwak, Tibeto Neushno.
[34:08:57] Yarl saw the big ass spider in the back. oh. I love you bro, I'm a huge fan been watching since your YouTube days keep up the great work. No one is gonna show up to Madison Square but just only you and fuck you to the people with the gay shit on Dead homies.
[34:09:05] Kai, I just want to touch your body and goon Goon to the night's sunrise over the horizon.
[34:09:09] Holding hands while we look each other in the eyes.
[34:09:13] Gooning to our heart content
[34:09:15] Lightning showers
[34:09:16] Lightning showers
[34:09:17] Lightning showers Lightning showers, lightning showers, lightning showers, lightning showers,
[34:09:20] lightning showers, lightning showers, lightning showers. Hi, how can you sleep with that light in your face? You are the best G.
[34:09:51] Kai let me shove my dick in all your tight holes and lick you from your head to your toe. Let's fuck till the fucking sun comes up, it'll make you love dick like Terry Snow tomorrow. I know your
[34:09:55] heavy cock is too much for your back heel hole.
[34:10:09] Kai, we are literally not joking We saw a mysterious tall black figures with the top hat behind you.
[34:10:13] Look behind you, look behind you, look behind you!
[34:10:20] Your dick is out, Kai.
[34:10:29] Let me hear you say, off-ho, ho, say, off ho, off ho, mustard on the beat, ho dee bow. Any rap nigger, be a free throw man down, call an ambulance, tell him, breathe what what what what dot fuck him up what
[34:10:48] what what what i'ma do my stuff why you trolling like a bitch ain't you tired trying to strike a chord
[34:10:55] and it's probably a minor they're not like us
[34:10:58] they're not like us they're not like us they're not like us
[34:11:01] they're not like us they're not like us. They're not like us.
[34:11:07] Michelle Obama spam will be so confused.
[34:11:29] I just want to spread a tight little asshole my glorious Kaisenit the third.
[34:11:35] I love you so much my love, you don't understand how many times
[34:11:38] I stroke my shit to you every day. Also may have suck my dick
[34:11:46] Wake up please! Up, up, up, up, up, up, up.
[34:11:52] Wake up Kai please. Latin alphabet, latin alphabet, latin alphabet, latin alphabet, latin alfa-
[34:12:03] I love you daddy your gonna make me come foo fooo foo foo foo foo foo yes dad g im gonna come and you make me come fufu-fu-fufu-fufu-fufu-fufu
[34:12:08] Yes, dad. Gee I'm gonna cum you make me wek
[34:12:11] Are you like mine as your a bitch? How ass ameth
[34:12:17] Why is Michelle Obama sleeping right now?
[34:12:29] Has Michelle Obama betrayed her? has michelle obama betrayed on yet Havoc has closed and sleep on the floor if her gay and like dick in her butt. butt michelle obama wakes the fat cup Hi Kay, I'm a big fan. Wish I could see you.
[34:13:03] Well BTW can we only be friends though?
[34:13:08] Oh, I'm sorry. befriends though.
[34:13:17] Michelle Obama, Michelle Obama Michelle Obama is chi
[34:13:19] lowercase, lowercase
[34:13:21] lowercase, lowercase lowercase, lowercase, lowercase, lowercase, lowercase, lowercase, lowerk Michelle Obama wakes the fat cap. awake the camp... Shh!
[34:14:40] Wake up, yes daddy wake up. Don't move I'm about to finish, yes.
[34:15:03] Bomb has been planted Bomb has been defused.
[34:15:20] Wake up or tither, USA, evil, party face, present, Canada, confetti ball, bowing deeply, bear, maple leaf, person shrugging, fair skin, party popper, thumbs up Grimacing face, folded hands
[34:15:22] Grimacing face, cold face
[34:15:25] Eagle, waving hand
[34:15:27] Embarrassed smiley face
[34:15:29] Up, up, up, up, up, up, up, up, up, up, up, up, up, up, up, up, up, up, up, up, up, up, up, up, up, up. Brain, devilish face. Imp, pouting catface. Skull, pouting catface. Ghost.
[34:15:50] Lamar the actual grunt that won the sub gifting didn't actually get it, can we get an F in the fucking chat? Skull folded hands....
[34:16:06] Kite, looks like you have a big fat boner.
[34:16:09] Let me suck it dry please!
[34:16:11] Inverted exclamation mark
[34:16:12] Inverted exclamation mark Inverted exclamation ma- Please invert! Exclamation mark, invert!
[34:16:18] Michelle Obama kind her bad THO. Look at her massive bonus she got right now.
[34:16:29] My sprinkler goes like this...
[34:17:54] Don't come near me! comes back like Michelle Obama got a fat cock. Aubergine, aubergine, aubergine, aubergine, aubergine, aubergine... I know your ass ain't sleeping phantom on his way, John. SCHSCHSCHHSCHHC c h s c h s c h.. Only up, only up, only up, up maple leaf. Bind deeply skull depth..... Can I put your boner down? You're making me horny.
[34:19:01] I cannot bear to not suck IT dry.. I would like to see one of the AMP members blow that bitch up while he still has the Elder Ring decorations on July 4th........... My British voice is actually ass. Good night!
[34:21:51] Fain, fain, fain, fain uh Sane thing thing thing thing thing thing thing thing thing thing thing thing thing thing thing thing thing.............. One out of ten. How tired are you, chat? Have you already slept? Are you in another country? Have a blessed day, all....... chat let's get the next poll to 50-50 dead even............. My load, oh my god it's coming, oh my god let me hold your dreads nice and tight
[34:29:35] Hold still Michelle Obama......... so Lord, cover kind with the blood of Jesus Christ. I break every demonic attack and witchcraft against him in Jesus name. Protect him lord and continue to reveal yourself to him, may you call him closer into relationship
[34:31:53] with you in Jesus' might name.
[34:31:55] Amen. Praying gesture. I love when your move is open like that for daddy you're such a good boy oh my god..... I want to oil up Michelle Obama's feet.... so........................ Twinkle, twinkle, twinkle little star how am I wonder what you are up above the world so high like a diamond in the sky.
[34:38:44] Twinkle, twinkle little star how I wonder what you are....... Australian For we are young and free We've golden soil and wealth for toil
[34:40:14] Our home is girt by sea Our land abounds in nature's gifts of beauty
[34:40:18] Rich & rare in history's page Let every stage advance Australia fair State Advance Australia Fair........ Love from Nigeria Kai, would love to meet you when next you come by. You made me want to dabble in this streaming thing,
[34:42:04] saving to get a PC so i can start creating content on YouTube and Twitch. Wish me luck brother.............. Row row row your boat gently down the stream, Merrily merrily merrily life is but a dream........ chat should kai stream sparking zero when it drops or black ops six okay so. Good morning, Pookie.......................... Cheer 1000 with friends to- LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllll nine nine nine.............. Can we friendstoke? Are we friendstoke? Are we are just friendstoke?
[34:55:04] 82 septentridge, intillion eight hundred and twenty-eight sextridge,
[34:55:08] intillion three hundred and seventy-three quinta
[34:55:10] which until seven hundred and thirty-seven or two region to
[34:55:14] four hundred so...................... Okay. okay............. can't can't can't... Wait, wait, wait, wait, wait, wait, wait, wait, wait.
[35:02:54] You can't just wait..... um.. I'm sorry.
[35:04:26] Cock cock cock cock cock cock
[35:04:31] cock but we're friends, T-H-o cock cock cock cock australia oh. Your feet look nice, Kai, but we friends too... No smoking symbol, no smoking symbol Non-smoking symbol No smoking symbol.
[35:06:28] Feet pick please a dollar and and a dollar and and a dollar at and percent of percent and that percent at hash atom dollar and hash
[35:06:36] A dollar is percent. Hash percent hash and hash percent hash percent underscore hash hash
[35:06:44] Someone out here is gonna
[35:06:46] hop you in the toes if he ain't more
[35:06:48] careful.. okay Newbie symbol, newbie symbol, newbie symbol, newbie symbol, new b symbol Newbie Symbol newbie symbol, newbie symbol, newbie symbol,
[35:07:47] newbie symbol, newbie symbol, newbie symbol
[35:07:50] newbie symbol, newbie symbol, newbie symbol
[35:07:54] newbie symbol, newbie symbol, newbie symbol newbie symbol, newbie symbol New Bassemble newbie symbol, newbie symbol, newbie symbol,
[35:08:20] newbie symbol, newbie symbol,
[35:08:22] newbie symbol,
[35:08:24] newbie symbol,
[35:08:26] newbie symbol,
[35:08:28] newbie symbol, newbie symbol, newbie symbol.
[35:08:32] The first time I saw the Chinese for emptiness or sky chinese for emptiness or sky
[35:08:52] chinese for emptiness or sky chinese for emptiness or sky
[35:08:56] chinese for emptiness or sky chinese for emptiness or sky chinese for emptiness or sky chinese for emptiness or sky chinese
[35:09:23] for emptiness or sky chinese for emptiness or sky
[35:09:31] wake up and clean your damn feet.
[35:09:42] Wee friends though, wee friends though, wee friends, wee friends though we friends, still we friends, still we friends, we friends,
[35:09:56] still we friends, still we friends
[35:09:58] though we friends, though we friends
[35:10:00] though we friends, though we friends
[35:10:02] though we friends, we friends
[35:10:04] though we friends, though we friends though we friends are we friends so we're friends
[35:10:06] are we friends are we friends though me me move move move move move move move move move move move move move move
[35:10:39] red leather yellow leather red leather yellow leather red
[35:10:46] dick Dick. We friends DHO.... Potato, tomato, Trinidad and tobago
[35:11:53] potato tomato trinidad and to bago potato
[35:11:57] tomato trinidad and tobago potato tomato
[35:12:01] trinidad and Tobago......... My rofulcopter goes, Chinese for nothingness,
[35:13:50] Chinese for existence, Chinese for nothingness,
[35:13:53] Chinese for statement, Chinese for moon, Chinese for management,
[35:13:58] Chinese for statement, Chinese for Management, Chinese for Statement, Chinese for Existence,
[35:14:01] Chinese for Statement, Chinese for Nothingness,
[35:14:05] Chinese for Existen...
[35:14:09] You you you you you oh. alarm alarm alarm.............. oh okay................... Hey can I fucking wake up......
[35:21:44] Kai sleeps like a maniac lol.
[35:21:48] ... I am telepathically speaking with my sister she says put my nigger put my
[35:21:58] nigger pulled my nigger pulled my nigger pulled my He says put my nigga put my nigga put my nigga put my nigga put my nigga put my nigga put
[35:22:02] my nigga put my nigga put my nigga put my nigga put my nigga put my nigga, my nigga poop my. Wake up, wake up, wake up, wake up, wake up, wake up, wake up, wake up, wake up.
[35:22:50] Proudhondiddy is waiting.... Okay.... Hey Kai, just wanted to say it was awesome to meet you at that Diddy party. The way you licked my toes had me stargazed...
[35:25:10] Wake up, wake up, get up. Duke watching you sleep on Ren with Ray. Wake up wake up! But we friends though, wake the fuck up all like Dukas...... Tee standing in your doorway, bro wake up..... so. I'm going to try and get the Diddy is waiting... Hi, Charlie. hi Bro wake up. Wake you peepee wake up wake I pee kai kai k wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up.. Radon is gonna double dip his nutsack in that open mouth of yours if you don't wake up. On Diddy!........ wake up ty Tyler's friend............. The fact 38k people are watching this man sleep is wild. so.. again again again again again again again again again again again again again again again again again again again Kai getting diddy downed by Ra Dan.
[35:34:57] Tyler said we can be more than friends if you wake up and beat Radon.. Wake your dirty ass up and listen to Sick Santa........ English English or Spanish for everyone voting......... Hey Kai, as you might know it's Tuesday. Touchy Tuesday to be specific. Oil up and get ready, I'll be there in 45 minutes.... Okay. Hey Kai, I want a finish on your forehead.
[35:39:52] I think it's quite possible cause of the size of it.............................. Since this gay 4 feet 4 inches New York rat won't wake up, I'll explain my surroundings.
[35:45:21] I'm currently in a beach bed in Greece and this fat guy has his swimming shorts halfway
[35:45:27] meaning his glutimous Maximus is sticking out. I wish
[35:45:31] Kai would show me his Glutomous Maximus.... A friend. A friend is someone we turn to when our spirits need a lift.
[35:46:24] A friend is someone we treasure, for friendship is a gift.
[35:46:28] A friend is someone who fills our lives with beauty, joy and
[35:46:34] grace. A friend makes the world we live in a better and happier place. Thank you
[35:46:40] for being my friend! We friends too. Sincerely, Tyler... I don't want to go to work today, sheesh... breather............ Can I get those chopped cheese sandwich hands off your shmeet please?
[35:50:33] I would like to watch a different type of show.
[35:50:37] I'm sorry, but I can't do that. chopped cheese sandwich hands off your shmeet please i would like to watch a different type of
[35:50:40] playing thanks...... Thanks for recommending me those pee-pee pills, Kai, i can see why you use them....................... 41k people watching that midget from Game of Thrones sleep is insane. insane................... Whoever message next is gay.... I'm not gay, okay you munchkin oompa loompuy what table are else? look we want Kevlar out.... I'm going to go and get some food.
[36:01:42] Kale, you better get up! Radorn is behind you and he wants to eat your cake! Get up now! BBL Kayla BBL Kizzy BBL Kayla BBL Kizzy BBL Kayla
[36:01:48] Wake up now BBL Kizzy, BBL Kayla. Wake up now, BBL
[36:01:50] Kayla. so.............. Don't move, I'm almost finished............ I'm sorry.
[36:09:10] Kai, there is police outside your fucking house.... He thrust it, let him drink water um uh.. Yo Kai, why is your bed small and short just like you? Hm? Did you get it from the toddler section? Ha ha ha. Wake up!....
[36:10:03] ...
[36:10:07] Hi, wake the fuck up there is 35k niggers in here you bitch. Ah ah ah ah ah
[36:10:09] HHH AHH HHH AHH H the chat..... You can just take that back, boy.
[36:11:24] This order given by beginning of a rather
[36:11:29] thin time for Jem and me. My fists were clenched and I was ready ot let fly. Atticus had promised
[36:11:35] me he would wear
[36:11:36] me out if i ever heard of the schoolyard the day before that Scout Finch's do you
[36:11:41] defend Atticus? I asked him that evening. Of course, I
[36:11:45] do don't say Scout. That's...
[36:11:50] Hi wake up and you won't be friends though with Tyler Bumassniggerdukeaboutcomingalickyourfeet Niggaduke about coming a lick your feet.. Mr Beast donates $1 to Black Monk who?..... Back shots for Kai in 1, 2, 3... two, three. dust. Mr. Beetz has donated $5 through Super Chat.
[36:14:19] Can I use your task, nigga? Wake up Desmond Benjamin....
[36:25:51] Hi, wake the fuck up. I'm in the locker room and trying to see you beat Radon before I got football.............................................................. I'm sorry.
[36:25:56] Warmy, rolling down the street with a dick in my butt.
[36:26:00] Quack rolling down the street with a fucking dick in my butt. Quack, rolling down the street with a massive fucking dick in my butt......................
[36:29:32] Wake up, Fanum is about to tax your skibidio higher as giant holy sigma he's behind you hashtag what the sigma hashtag.......... I'm going to go with the
[36:31:32] same one.
[36:31:37] Chat, what is the prediction that kai will surpass his
[36:31:42] elder in base game death count also losses a tubby lardas..................... Wake up dwarf, it's time for Elden Ring... but we friends tow but we friends tow. The team goes Scraw, Pap-Pap-Ca-Ca-Caski-Deekey-Pak-Pak and the Pooh-Poo-Pa-B skidiki pat pat, and a poo poo pa doom skiya
[36:36:52] doo dee coo coo doom doom poom poom
[36:36:55] you done now...... ring, ring, ring, ring, ring, ring, beep.
[36:38:11] Beep rise and shine meager.
[36:38:18] You are you are
[36:38:24] English or Spanish? english or spanish........ You are a little, little, little, little, little, little, little, little, little, little, little, little, little, little, little, little, little, little, lil, my fill cup to go.
[36:40:13] Sigh, sigh, sigh, sigh, sigh, sigh, sigh, sigh, sigh, sigh, sigh, sigh, sigh............... Hi, I'm Cynad and Tyler the creator sitting in a 3k issing first comes eldon then comes lord
[36:42:46] tyler is a little bitty. S, s, s, s, s, s, s, s, s, s, s, s, s, s, s, s, s, s, s, s, s, s, s, s, s, s, s, s, s, so ssss.......... I'm sorry. Kai is so black bro. HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
[36:45:39] And beautiful PogChamp, PogCham, PogCham, PogCham, PogCham, PogCham, PogChamp Pop, jam, pop pop champon champon champon champon champon..... Hello Kai this is Tyler, I just wanted to tell you I love you.
[36:47:26] Psyche! We are just friends.
[36:47:28] We friends too.
[36:47:30] We friends. The best of friends.
[36:47:31] F R I E N D S
[36:47:35] Friends. Get that through you big head
[36:47:37] You dirty little midget
[36:47:39] We are friends d h o We are friends D H O, we're friends too.
[36:47:45] Kai is a black nigger, do you like Fortnite Battle Royale?
[36:47:49] Kai's a black nigger, do you like Fortnite Battle Royale? Kai's a black n. Do you like fortnite battle royale?
[36:47:52] Kai's a black nigger. Do you like fortnite battle royale?
[36:47:59] Rise and shine the okay Okay, okay.
[36:50:49] This story is called The Ugly Midget. Once there was an ugly midget, he was so ugly that everyone died. The end........... care as engine care as engine care as engine k r s engine k rs engine k ascension care and sins in chaos Hello everyone, I'm from France. W in the chat for the coat. Country of all time. Have a great time out here, France, France.
[36:51:20] Kai, sleep if you gay! Why are you still sleeping? Are you gay? I knew it. I knew you gay.
[36:51:28] Can't send it to Sky everyone. Gay. Gaiy. Gay. Jgay. Kjgaaaj. Gay. gay which gay............ I'm sorry.
[36:58:32] Kai, I know your room smells musty as fuck..... Sleep. Sleep if you enjoy watching hentai. That's what I thought freaky asnika.... But we friends too. Hi looks so cute when he's sleeping. So cute I call just nut on his face. Please.. There's a roach......... A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q J K L M N O P Q R S T U V W X Y Z Zed.
[36:58:39] Kai, could you stop snoring? Neighbors message.
[36:58:46] If you move your gay if you get up your straight u bitch ass nigger wake tf up and brush them chops dirty rat ass nigga word is bond.. I'm sorry. I'll be right back.
[36:59:34] Just realized your goofy ass has T.T.S on, so I'd like to congratulate you on being H.I.V positive gang. Keep up the good work, front-facing baby chick, front facing baby chick. I'm not sure if that's the right word.
[37:00:10] I don't know what it is, but I'll try to remember.
[37:00:15] I think this one is a bit more difficult than the other ones. If you type your gay.. I'm not sure if that's the right word for it.
[37:00:42] I don't know what you're talking about, but...
[37:00:47] I think this is a good way to end the video. fucking Vaseline.. chat type one if you want car to wake up.... Chat type 69 if you want to sniff case Skibbity Sigma Feets. skip ed sigma feeds.. Yo everyone stop typing for a minute and see how slow we can get the chat. I know there
[37:03:01] is gonna be a couple people who ruin it! Come on no typing for 30 seconds!...
[37:03:31] .
[37:03:35] .
[37:03:39] 111111111. 1-1-1-1-1-1-1-1
[37:03:42] 1-1-1-1-1-1-1
[37:03:46] 1-1-1-1-1-1
[37:03:50] 1-1-1-1-1 one one one one one one one one one one one one one one one one one one one one one
[37:04:43] 1 2 3 4 5 6 7 8 9 10 1, 2, 3, 4, 5, 6, 7, 8, 9, 10,
[37:04:46] 9,
[37:04:47] 8
[37:04:48] 7
[37:04:49] 6
[37:04:50] 5
[37:04:51] 4
[37:04:52] 5
[37:04:53] 6
[37:04:54] 7
[37:04:55] 8 9 10 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 15, 14, 15, 16, 17, 18, 19, 20, 21, 22, 21, 20. 21 22 21 20 23 24 27 25 22, 23, 28, 29, 30, 28, 31, 32, 33, 34, 31, 34, 35, 36, 37, 38, A, B, 39, 40, 4, 41, 42, C, 43, 44, 45, 46
[37:06:01] 42, 47
[37:06:04] 48, 49
[37:06:07] 50.. Inverted question mark, inverted question mark, inverted question mark, inverted question mark inverted question mark inverted question mark inverted question mark
[37:06:55] inverted question mark inverted question mark inver-
[37:07:02] Hey Alexa call call 911.. Kai, could you also stop breathing? I feel like I'm living with a cargo ship. Message from my neighbor. 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 13 33 34 35 36 37 38 13 9 40 41 42 43 44 45 46 47 48 49 50 51 52 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63. 58 59 60 61 62 63 64 65 66 67 68 69 70 71 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 991, 101 97 98 99 1 100 1 hundred and one one hundred and two one hundred and three
[37:09:19] one hundred and four one hundred and five one hundred and six Conch Riton 4-1 Conch Riton 5-1
[37:09:23] Conch Riton 6-1
[37:09:25] Conch Riton 7-1
[37:09:27] Conch Riton 8-1
[37:09:29] Conch Riton 9-1
[37:09:31] Conch Riton 10-1 1, 112 1, 113 1, 114 1, 1151, 116117118 Hi, stop dreaming about pounding Tyler's puss and wake up you dumb little blob boy... Keep your hand in yo pants if you're gay.
[37:10:41] Earn what the sigma
[37:12:27] well We friends though, we friends though, we friends though, we friends though..... one one WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB WOMB one one one one one one one one one one one one one one one one just for fun, may we all try and say Kai wake up in the chat?.... Next person to donate is gay... Yeah. Okay. um um
[37:14:52] hey sir call 9-1-1 Hey Siri call 911.
[37:15:02] You dirty black nigger I am about to come rub you down in oil get up rat boy word is bond nigger nigger word is bond nigger listen to this song nigger. Hey Siri called you, hey Siri......... Hey, Pookie Wookie, good morning. Thought I'd let you know Tyler joined at approximately 742 AM and said hey! We still just friends though.
[37:17:13] Have a good night, front facing baby chick,
[37:17:23] front-facing baby chick, front-facing baby chick
[37:17:27] front-facing baby chick, front-facing baby chick
[37:17:31] front- facing baby chick...... Chinese for nothingness, Chinese for existence, Chinese for nothingness,
[37:19:04] Chinese for statement, Chinese for moon, Chinese for management,
[37:19:09] Chinese for statement, Chinese for existence,
[37:19:12] Chinese for statement, Chinese for nothingness,
[37:19:16] Chinese for existence, Chinese for nothing............ Thanks y'all for giving me this chance also thanks to my parents for this achievement we finally talking to 33k gay people.
[37:21:40] Today is your day, you are the chosen. You defeat every obstacle in your way.
[37:21:46] You sleep in peace, you dream good dreams. You are powerful. I want to slow dance with you and feel your body grind against mine while While your dreadlocks blow in the wind
[37:22:12] and we both stare into the sunset, I want to feel you bone a press
[37:22:16] against me until i get on my knees and suck it. circuits.. so you're going by kc now nerd haha what's up douchebag it's radonon from Anearhythm. Remember me? Me and the guys used to give you a hard time in Shadow of the Erdtree. Sorry you were just an easy target lol. I can see not much has changed. Remember Tyler, the girl you had a crush on? Yeah we're married now.
[37:23:19] I make over 200k runes a year and drive a Mustang Spectral Steed.
[37:23:24] I guess some things never change, huh loser? Nice catching up lol.
[37:23:29] Pathetic......... so uh. okay........................ I feel more grateful each day.
[37:30:10] I accept myself for who I am and create peace, power and confidence of mind and of heart.
[37:30:16] I wake up motivated.
[37:30:18] Happiness is a choice, and today I choose to be happy.. But we friends too..... There are four big 300 pound black men with 10 inch meats dangling over you right now....................... Okay. Tyler just tweeted something about you........... Kai you look like the type of guy who eats a Snickers upside down while you masturbate.
[37:38:27] Dirty ass bitch asshole ass nigga. King of the rats ass nigga. This is Tyle left you for me and now we're engaged...... so. I'm sorry. I was just trying to figure out what the hell you were doing.
[37:40:00] I don't know, but...
[37:40:02] I think it's a good idea for me to go back and look at this.
[37:40:06] I'll be sure to do that. Okay. Yoka, it's 12 o'clock gang.
[37:40:15] Yup. Yeah. hell oh..... uh I'm going to go get some food. now.. Wake up. foreign oh um um now
[37:43:39] wake up wake up wake up wake up wake up wake up wake up wake up wake up wake up
[37:43:44] wait couple roses are red violets are blue, your dong is massive........... How does Brother's Arms not fall asleep? Wake up, fool! I'm going to go ahead and do that. Help, help, help... What is that crawling on his arm?
[37:47:13] Can we get an Amen in the chat? Folded hands.
[37:47:21] Wake up radar and is waiting LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllll. hello... success. I'm going to go and get some milk. I am very happy to is going to do so.
[37:49:28] I have been given a lot of knowledge in order to be able to help you. We just phones though.. ee
[37:50:02] kevin it is time to get up now wakey, wakey, wakey, wakey, wakey, wakey.
[37:50:12] Your radar's bitch! radars Hello?
[37:52:04] Anyone else see that Ice Spice is watching kai clips in a hot tub? so is oh search LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllll toe. You're grabbing your balls harder than Radar and fucked you yesterday
[37:53:41] got a new motorcycle that goes... This sleeping position screams we found Solo. though. Where are people from Venezuela? I'm sorry. Stoke, are we just friends? Oh now let's drop this beat I'm sorry, I just wanted to say that I was a little bit nervous.
[37:53:51] I don't know why I didn't tell you guys about this, but I did want to let you know that I was going to be in the video for a while.
[37:53:56] I'll try and get back to it as soon as possible. Viva Venezuela! Que chévere!
[37:54:08] Dixie Normus, Harry P. Ness, Joe King, Liquor Box, Porkela Hamburger Suenmi Pantalone S....... If he gripped the controller the same way he grabs his capé, he would have finished
[37:55:46] Held and ring by now.... um l l l l l l l l l l l l l l l l l l l l l l l
[37:56:45] trying to strike the in ring it's time United States of America we need you to wake up and oil yourself up and be
[37:57:03] telled in ring it's a matter of national security did he find that spider Kevin
[37:57:10] Hart left in his room yet?
[37:57:19] We ain't letting you sleep all day wake up and show Radan who is the real bitch that is sleeping zzzz so not zzaaah........... Alexa, my Tootsie Roll double bubble gum........ I'm going to go and get some food. oh............ I love the way he sleeps............ I'm sorry.
[38:05:31] Freaky ass nicker he's a 69 tie freaky ass nigga he's a 69k. I'm not sure if you can hear me.
[38:06:20] Can't wake the fuck up before I go over there and wake you up by sucking your big black meat.
[38:07:53] Chat chat chat has he beat the final boss....... I'm sorry. I was just trying to figure out what the hell you were doing. I don't know, but...
[38:07:55] I think it's a good idea to go back and look for him.
[38:07:57] I'll be sure to do that.
[38:07:59] I've got some more information on my computer.
[38:08:07] Kai, you look like the type of guy who eats Oreos while masturbating, you dirty ass bitch-ass hoe-ass nigger. Wake the fuck up and beat Elden Ring before I nut on your face! not a new face........... I should watch Zero Lenny beat the game with a torch................... I'm going to rub one out while you sleep.............. so......... Thank you.. We friends too............ so............................................................................... so........................... Wakey wakey little dude......................... so. I'm not sure if this is the right way to do it.
[38:45:03] I don't know what's going on here, but I'll try and find out.
[38:45:08] I think that was a good idea. Wake up before I go and touch the tip we just friend's toe. I wanna jerk off to you so bad!. so........ Hi wake up a big monster is chasing oh tiny as triple seven triple seven triple seven triple seven triple seven triple seven triple seven triple seven double seven Wake up, baby boy. I'm gonna bust all over you if you don't ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ha-ta-ta... Dear Heavenly Father, I'd like to set a prayer today for Lord Dwarf Kysenet the Elite Gamer to complete his final task of beating Radan and celebrate his sweet victory getting St making a sturdy smoking and pack...... Follow Kozikman on Twitch, you heard? Follow Kozikman on Twitch. 777 777
[38:50:11] 777
[38:50:13] 777
[38:50:15] quadrillion
[38:50:17] 777
[38:50:19] 777 7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777722,. Rock-a-bye baby, on the treetop When the wind blows the cradle will rock
[38:50:49] When the bud breaks the cradle will fall And down will come baby cradle and all rocker by baby gently you swing over the
[38:50:58] cradle mother will sing sweet is the lullaby over your nest that tenderly sings my baby to rest.
[38:51:06] Wake up bitch the hoes are waiting uh. so... foreign..... We just friends to, we just friends to, we just friends to, we just friends to wake up baby boy. Taylor Earth's hero is a god..... so... But we friends though, but we friends though, but we friend so.. I'm sorry.
[38:56:59] Brother Hoes are waiting. Get up! Too much motion to be sleeping all day.. I gave me sweat, make me hotter, make me lose my breath. Make me water, make me sweat, make me hotter, make me lose my breath.
[38:57:03] Make me water. water.. uh one shade and move. I've almost finished..... Wake up you have come dripping out your mouth. The whole chat is jerking off to you I don't know if you heard but Keso is changing his name to puff roast malone.............................. Okay. Can I get the.. I'm sorry.
[39:10:09] Yo Kai wake up it's 10 30 am today is the day Brass Key. Ain't no way you don't beat IT today............ Wake up you, black heart squid.... Yo, Pookie wake up gang. Sleep is for the weak...... so Wake up tile here.
[39:10:54] Ty do you need that Hawk tier to wake up.. We know you're awake. wake we friends t-h-o we friends toe we friends toe we friends toe, we friends toe, we friends toe, we friends toe, we friends toe.
[39:11:15] Wake up daddy! We all miss you. Sike we all gonna cream pie that lil tight ass of yours.
[39:11:30] Oh my god. three gifts to the next three ppa who cheer after this post. I thought that was a Bronx rat for a second...... This
[39:13:21] is real life snoring. We friends, though we friends, though we friends, though we friends, though we friends, though
[39:13:35] we friends. Still we friend, still we friend, still we friend, still we friend, still we friends friends though we friends though we friends though we friends though we
[39:13:49] friends though we friends though we friends though we friends so
[39:13:56] you can keep air wake. Your arm broke..... Hey Zedekai, I want you to create a nuclear combustion inside of me. chat LKC3 to 1v1 me take an 8 run this hand spoy he scared to box no no no no no Wake up, Kayla. Wake up, Kayla. Wake up, Kayla. Wake up, Kayla. Wake up, Kayla. Wake up, Kayla. Wake up, Kayla. uh. Hi Harry, Melania is outside and she's topless shush..... Yo, I'm about to feel like ants when you wake up. Let's get on
[39:17:23] on on on on on on on
[39:17:27] on on on on
[39:17:31] on no no no.....
[39:18:28] .
[39:18:33] . no no no......... I'm going to go and get my breakfast.
[39:20:28] Good morning time for breakfast.
[39:20:33] Breakfast is ready pookie bear!. so so.. I want to see the fastest tail spam yet again. Go! Slash faster, slash faster. right magnifying glass, left magnifying glass, left magnifying glass, right magnifying glass, left magnifying glass, right magnifying glass, left magnifying glass,
[39:22:33] right magnifying glass, left magnifying glass
[39:22:37] right magnifying glass, left magnifying glass last run I'm not even gonna lie... If nobody types Ty Frank as emote right now they are way gay. away gay
[39:23:40] can i wake that juicy up and hop on elden ring before i come over and hit it
[39:23:44] from the back... so. I got a $5,000 bet that you will beat the game today. Show up for me dad!.. get up big boy don't forget to show us what's in the bag... I'm going to try and get the key.
[39:26:07] Can I eat this corn a long way?
[39:26:12] I'll have to go back in the bath with the lights off and pretend him in the womb.
[39:26:31] You're going to break your arm sleeping like that! Bro, are you gay? Just type Franker Z already. Skull, skull, skull, skull, skull, skull, skull, skull, skull, skull, skull, skull.
[39:27:04] Frank is... Chat is so immature y'all can't let him sleep after he just gamed out for like 10 hours straight grow up and modzial should be helping out...
[39:28:09] Hawk to Spit on that thing. And, and,
[39:28:11] and, and and and and and and and and and and and and..... okay type one if you want thunder or spax shots from tv hmm. so so so so so so so so so so so so so so so so so so so so so so so so so Skull, skull, skull, skull...
[39:30:09] Freaky ass nigga. he is 69 god hey.
[39:30:11] Hey!
[39:30:13] Run for your life hey!
[39:30:17] Run for your life let me hear you say
[39:30:22] Say Wife let me hear you say, off hoe, off hoe. Say, off hoe, off hoe then step this way.
[39:30:25] Step that way then step this way.
[39:30:27] Step that way are you my friend?
[39:30:29] Are we locked in?
[39:30:33] Meow are we locked in? Meow meow meow meow meow meow meow meow meow meow meow meow meow meow meow Meow. Meow. Meow. Meow.
[39:30:57] Radon is waiting..... I like the lawnmower goes shir-shee-ee-ay-ray-ray-ray-er, vovum-sharey and writes burners go wow ow ow ow ow ow ow ow oh chat type one if kai fly high sky why kissy kissy on lip a rule Let's all woof like good little pups. Woof, woof, woof, woof, woof, woof, woof, woof, woof, whoops whoops whoops whoops whoops whoops whoops whoops whoops whoops Woof, woof, woof, woof, woof, woof,
[39:32:42] woof, woof, woof, woof, woof.
[39:32:49] Hey! Hey! Hey hey hey, hey, hey, hey, hey, hey, your mom got me in bed.
[39:33:00] One wrong call and that arm and it's over.
[39:33:09] What is happening with his arm? Holy shit.... Overall under 1000 deaths today..... If I was a mod, a lot of you guys would be timed out to MGMature ass kids sending stupid cheers,
[39:35:10] And stupid kids saying wake up after gaming for 10 hours a day for 100k pp eh? Oh baby, you're awake awake how good it is to see you.
[39:35:34] Meow meow meow meow meow meow meow meow meow meow meow meow meow meow Meow. Meow.
[39:36:02] He looks like when someone kicks the bucket in Family Guy and their arm is all behind him nsht lol Oh Find them in S-H-T-Lol.
[39:36:07] Pookie bear you up, ye?
[39:36:14] Chat... I feel it.
[39:36:18] Yeah, I feel it, I feel it.
[39:36:21] I feel it... Oh yes!
[39:36:26] Has been a long time. i feel it oh yes has zark wakey wakey pappy kai there's a car alarm going off from
[39:36:30] kaidan kisses now time to beat big boss
[39:36:35] good morning now time to beat big boss
[39:37:09] good morning kai i want to know what was in that bag 777 sextra gentilian 777 quintra gentilean 777 quadriord7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777, seven hundred and seventy seven in the attraction to leave
[39:37:15] come on a chat
[39:38:23] CHAT! Check! so so you gotta get high like this me I'm gonna be made some dissed, I'll just keep pissin', I don't give a fuck. I'm on my new boy bitch, she's kinda scary, I hope no fun.
[39:38:26] When you're under those cutties and you got the most money, why are you talking about me?
[39:38:30] Everybody gotta fucking get their hands up for everybody, everybody! is is All right. Oh uh is is is is yes is is is is is I spent that break, she needed that
[39:41:13] Baby please, they let it go
[39:41:15] I'm in the ghetto you know
[39:41:17] I'm a fucking liar
[39:41:19] I like to flash lights
[39:41:21] I like to show light streetlights All of my guys all over the place is is want you to see Get it right, get it right It's gonna get you there
[39:41:57] Look in my eyes
[39:41:59] And feel the pain
[39:42:01] That I've been through
[39:42:34] Get it right, get it right is is We just going, going, going, going, going, going, going, going, going, going, going, going, going, going, going, going, going, going, going, going, going, going. Solo quest! Solo quest! Solo quest! solo quest is um baby oh foreign so um um um I'm not gonna lie bro
[39:44:27] Yo chat
[39:44:29] It is time
[39:44:31] Chat it's time
[39:44:37] To hop out It's time to hop in the shower.
[39:44:56] Oh my God. It's time to hop in the shower Go take a quick shower chat and we have it on this game ASAP
[39:45:01] We got I'm gonna shower you gotta eat real quick. And we got a hob this game ASAP, alright chat?
[39:45:08] Alright?
[39:45:15] Yo,
[39:45:16] this nigga is stupid.
[39:45:17] Alright baby!
[39:45:20] BOMBINUS!
[39:45:27] That was some good sleep.
[39:45:29] That, that was some good sleep right there. so.. so so Check! Now start getting good flow. Let's go ahead and execute that flow. I'm going to go slow.
[39:46:46] Okay, go slow last night, y'all.
[39:46:50] Who was here last night? Hey, yo!
[39:46:55] Bro! okay so so so um um He speaks all of the head, his song and he slams away
[39:48:09] But I'm forgetting these words
[39:48:11] The whisper is so strong it rages my palms
[39:48:14] And it keeps on looking when you broke down
[39:48:17] The whole crowd goes for a laugh Your voice is loud and your words won't come out is I'm sorry. is is is I'm a super hero, one for the lifetime I'm a superstar
[39:49:13] Take me to this whole space
[39:49:15] This world is mine so you take it
[39:49:17] Take me as we rise and fall
[39:49:19] Before I'm gone
[39:49:21] I never want to land in a storm The superstar that's supposed to boast more is is is um is is is is is is is is is is is so so so I'm going to show you how to do it. uh um is oh is is is hey is Oh, man! uh I'm the first and I'm gonna shine forever The cold, you know I'll be here for a long time
[39:54:45] And if it doesn't make me feel it
[39:54:48] Then I won't come to get up till the end
[39:54:51] And after this second, I can hold it ever Before then we'll feel so sadly is my is is is oh um is is so is so I'm gonna make you feel like you're in my arms real quick bro god damn Thank you. um I can't figure it out, there's something about her
[39:57:46] So who is it talking about?
[39:57:49] Everyone in the party gonna make a kill
[39:57:52] This is how all y'all niggas don't be dancing, bro.
[39:57:56] This is how I know y'all don't be dancing with no bitches!
[39:58:01] What you mean? Hey yo that's why you...
[39:58:04] That's why you do this something about this so that's how you got them over there like
[39:58:08] they said i can't be like what are you talking about what are you talking about Ow!
[39:58:25] That's how you want to move!
[39:58:48] Fuck. I can't figure it out, there's something wrong Cause you walk like a ball, talk like a ball
[39:58:53] Make new things, make me fall
[39:58:56] Shit's funny how you do this Wow, that is scary as fucking ass oh is We take it in, won't you come and spin a little party
[39:59:23] I don't want to be in this
[39:59:26] That's why I love, love, love
[39:59:28] We take it in
[39:59:45] Ooh, what a sight uh Cool, cool, cool, cool
[39:59:48] Ooh there's something about Get a moment that I can do for us
[39:59:51] I like it hurt and makes me cry is oh like I was only born to take things that she couldn't give up
[40:00:26] Now I'm thinking about this whole other matter
[40:00:30] If she had a woman, please
[40:00:33] That's why I don't care me oh um is me Oh, she got long hair
[40:01:28] And a full head of brown hair
[40:01:31] And the way you say it
[40:01:32] You can't even do what you do
[40:01:35] Spendin' on some of that
[40:01:37] She got, oh, she got, she got is I'm just a little bit sick of you leaving me all in
[40:01:51] That's why I love her
[40:01:55] No matter
[40:01:58] I'll be there Let go go Nikki!
[40:02:01] Let's go Nikki!
[40:02:09] I'm alive with the star in the sky
[40:02:12] I don't know about the choice to survive
[40:02:14] I believe that life is a prize
[40:02:17] But to live after me, you're alive
[40:02:19] I'm worried bout we and who I'll find out
[40:02:43] I get what I desire left it's locked and piled up And yes I pull shut is yes Yes, no I'm not risky, I'm pleasant Yes, cracker that should be big shit We put our pain to the world and all we
[40:02:46] Tell them what they're doing for you
[40:02:48] You are down drinking
[40:02:49] Downside Jamaica
[40:02:50] Clean through street food
[40:02:51] Give em' sweet old wood
[40:02:52] Mountain wood can't take me Cause I'm still good, hot and wood, can't change me
[40:02:55] Shout out to my haters, I'll get you back
[40:02:57] A-B-E, they just vindicated
[40:02:59] Only that one we done is normal, but we syndicated
[40:03:01] I know
[40:03:02] This night's just for mom, he up Every single minute of the time, he up is We can fit everything they could think of Greatness is what we wanna prove, cause
[40:03:16] That's the moment
[40:03:19] That's the moment
[40:03:22] That's the moment
[40:03:58] That's the moment is um um I'm a I'll, I'll, I'll No one in the mafia
[40:04:00] I mean the Dominican
[40:04:02] Big poppy on seats
[40:04:04] Shout out to
[40:04:30] Shout out Outro Music Yeah, yeah. We very afraid We telegraphers getting hot and carrying the waves Fuckin' me and Mickey didn't get married today
[40:04:32] And now you bitches got became bouquet bouquets
[40:04:35] Ooh, yeah
[40:04:36] You a star in my eyes
[40:04:37] You and all the white girls, party in box
[40:04:40] Are we trading a little more? I could buy me some socks
[40:04:42] I can't believe you really made it apart this price
[40:04:45] I swear man, I'm just one for the books
[40:04:50] Man, I swear this shit is as funny as it looks. I'm ready to make it more important because everybody passes and not everybody lives. is um so is I can't tell the time
[40:05:56] Take me away
[40:05:59] Under the sun and set
[40:06:02] I have become a light
[40:06:37] I'm shining i have become um uh I'm gonna make you sick and I'm gonna get high This is the first time that I've ever been to a party like this
[40:06:42] I'm gonna make you sick and I'm gonna get high
[40:06:47] You're alive! W-fucking-licky in chat oh nigga Now we ain't even fuck with you We have started in the back, had to stick them line up
[40:07:14] I'ma keep that shit stacked, so my fucking time gone
[40:07:17] Make it straight when it's shake or when it shine up Baby, tell me where you at, let me find a cop oh This is all I wanted, nigga.
[40:07:37] Of what I let you say in front of me, nigga.
[40:07:39] I ain't stupid and I'll die nigga
[40:07:42] A couple fingers with a couple triggers
[40:07:45] Fuck what you want when I fuck with you
[40:07:48] You big pot n***a once or two
[40:07:50] I should've been watching for the chuckle chew is Tell me you can go to town on my new hot fridge
[40:08:02] Got a nigga with a shop on my new mall
[40:08:04] Make him pay for the toy and make his home
[40:08:07] Get your wife, I need her star in seven dollars
[40:08:10] I will cut your golden door, tell you it's keepin' on
[40:08:12] And secondly if I want it
[40:08:14] On the carpet
[40:08:16] If you're nothing but more static, you don't have it
[40:08:18] How do you like to see that? Maybe silly or dramatic
[40:08:20] It will come and join in
[40:08:22] A few guys may win it Come to that fight it this is I'm a part of school, and it's a big storm Drugs need to rub my bones
[40:08:46] It's just a big storm in the club
[40:08:48] Nothing make it rain like water
[40:08:49] Nigga, we don't follow church
[40:08:50] No more about my boss
[40:08:52] Nigga, I don't trust niggas
[40:08:53] Ever since I was a young nigga
[40:08:55] Coming out, nigga Ain't nobody show me love Nigga, so let's fall is this is what that me me is is is I'm ready to make some good money Never run till the day it shows
[40:10:11] I've been stepping into the past
[40:10:12] I ain't looking for no more girls
[40:10:13] I don't need these ugly people pros
[40:10:15] They're meant to shut up schools
[40:10:17] And then they must have none
[40:10:18] They got bags and sticks in my face
[40:10:20] They just checking on me with men Red cats are where I live is is is is is I'm a real out there You can't miss it, I swear to you man Crazy man, I'm not some ninja
[40:11:15] I keep dancing like the other domains
[40:11:16] We're still alive, we got all the clans
[40:11:18] Set up brother and I'm gonna take the plunge
[40:11:20] Watch me rush down the trunk with my niggas
[40:11:21] I'm not that type of guy
[40:11:24] Let's go, my friend!
[40:11:27] Let's go, my friend!
[40:11:30] Let's go, my friend!
[40:11:32] Let's go, my friend!
[40:11:47] The so My name is Seth McPherson. I'm a student at Disney. I've been involved with fishing,
[40:11:49] and sailing multiple opportunities.
[40:11:51] I know my brothers are doing good
[40:11:53] and they're still getting some delights
[40:11:55] It's been an honor so I know we can ride the honeycomb back down is is um I'm listening.
[40:12:31] Thinking about the music stuck in my back, like a robot on Saturday nights
[40:12:33] I used to have an organ and go over to see a park
[40:12:35] with the playground from lock to bell
[40:12:37] Now it's lights and doors are shut
[40:12:39] I need some sleep while doing this job Not real, thanks um I'm gonna make you great. I think they're born safe.
[40:12:51] You know what?
[40:12:53] My genes, the demons,
[40:12:55] are going to get to a channel without me
[40:12:57] and I should have been bigger there
[40:12:59] but she's actually big too I've been trying out, and I'm sure she's in too.
[40:13:01] I can make her an outfit for us.
[40:13:03] What did you look at?
[40:13:04] I was like...
[40:13:06] No shit.
[40:13:08] Hey!
[40:13:10] You are not a human being. I bet you would not have a dick. um I bet that it's not even real I can't keep this little shit a-killin'
[40:13:23] I don't have the brains to tell you what to do
[40:13:25] It's like how we close in on reality
[40:13:27] But we don't get a deal
[40:13:29] Nobody's playing with us
[40:13:31] We're just as scared of pain We'll set up a new cell so is I'm sorry. oh um honestly uh I'm gonna follow your light
[40:14:49] Take you out of my free sweet home
[40:14:53] I'm calling on him to the double-dome file
[40:14:56] He always trying, trying his best to have a rapport.
[40:15:01] What else?
[40:15:03] Good morning chat good morning good morning good morning to the Tri-State area
[40:15:07] Fuck pay the platypus I'm big dude for for smircing this bitch focus you talking about nigga
[40:15:24] Good morning, good morning, good morning. Good morning.
[40:15:28] Good morning, good morning.
[40:15:30] Good morning, good morning. Good morning!
[40:15:33] Good morning!
[40:15:37] Holy...
[40:15:40] Holy... Jack you wasn't here last night? Holy. Holy.
[40:15:43] Chad, you wasn't here last night?
[40:15:45] We had good progress last night.
[40:15:48] Chad, we had good progress last night.
[40:15:50] We had good, good progress last night, bro. We have to maintain focus
[40:15:52] and we have to execute.
[40:15:56] We have to
[40:15:57] maintain focus and we
[40:15:58] have to execute. It is currently
[40:16:00] 1141, y'all.
[40:16:03] We're just currently 1141, yeah. We're at 956 deaths.
[40:16:07] Hold on my heart rate is fixed okay cool.
[40:16:11] I bet what else? I bet we gotta eat some food and then after we're going to react a little bit just a
[40:16:17] Little bit, and if we're gonna get straight into it
[40:16:19] We want to go straight
[40:16:27] straight it bro all right we're gonna get straight into it
[40:16:32] food of the day
[40:16:35] breakfast is ready! Want some hot tea?
[40:16:43] Is this honey
[40:16:47] put some in there
[40:16:54] all right put some of that tea and then we're gonna put let's see what we got into the day let's see what we got
[40:17:01] uh-oh same thing fire this is all i like to eat for breakfast, I ain't gonna lie.
[40:17:07] I love my toast with my egg and bacon simple straight
[40:17:11] to the point let's put some honey on the eggs
[40:17:15] I don't give a fuck if you don't do it. I do.
[40:17:18] Alright, put that motherfucker up like
[40:17:20] that.
[40:17:24] Honey on the eggs
[40:17:26] If you don't do that, you'll get black.
[40:17:33] Clean up real quick! Clean up real quick!
[40:17:36] Clean up.
[40:17:38] I think we got some juice. clean up.
[40:17:39] Then we got some juice.
[40:17:41] I believe you got some juice.
[40:17:47] We got some juice.
[40:17:49] We got some unfiltered apple juice
[40:17:54] Unfiltered, not the filtered one
[40:17:59] Unfiltered, not the filter one The baby, oh yeah the baby and um the age. Oh my gosh
[40:18:17] Shout out to them shout out to uh, uh... Whoever just reminded me.
[40:18:21] Holy shit, y'all on point today.
[40:18:26] Ty, you got that on point today.
[40:18:29] Let's see if it's good.
[40:18:36] Let's see if it's good Let's see if it's good chat. That's like the baby...
[40:18:44] I feel like in real life
[40:18:46] the baby a cool-ass nigga, chat.
[40:18:49] What's that thing?
[40:19:02] Hmm... Hold on to Halo with the fire, I can depreciate it. Nah, he is bro all right what's going on with you talking we
[40:19:10] finally got the goat the legend mr. the baby in a good man I don't want to bring
[40:19:13] brother to the witch for a minute you know what i'm
[40:19:14] saying huh what get this netflix stuff out of my face hold on little man you can't be
[40:19:20] mom police boy you look like you about seven eight once you're getting aggressive forward dog
[40:19:25] hey there you guys leave my little box What you getting aggressive for, dog? I got it. Hey, get up.
[40:19:26] Hey, hey, hey, hey.
[40:19:28] Hey, there you guys leave my little black friend alone.
[40:19:29] Little black man.
[40:19:30] No, who is this nigga?
[40:19:31] This nigga wearing a wild.
[40:19:33] I gotta tell you where I am, fellas.
[40:19:39] I'm an undercover mall cop, so you guys need to please calm down to please just told us who you were okay listen what you guys are doing here is illegal unless you got a permit you gotta you got a permit
[40:19:42] you got a permit man you got a permit, I didn't think so fellas. You safe with this program?
[40:19:46] No no no.
[40:19:47] I'm just gonna show up and take your drug dealer friends and Mr. Luigi and get on outta here.
[40:19:51] He said what?
[40:19:52] Yeah.
[40:19:53] What kind of friends?
[40:19:54] I'm making sure I heard it right.
[40:19:55] What kind of friends?
[40:19:56] Everybody know DA's don't do drugs
[40:19:58] You gotta think you're some big body actor
[40:20:00] Big body huh
[40:20:02] Big body cheese
[40:20:06] Yeah what about that? Big body!
[40:20:08] Big body on top! Big body on top nigga!
[40:20:12] World star! World star!
[40:20:15] World star!
[40:20:18] Now we got world stars! Yo.
[40:20:27] Flick. Yeah.
[40:20:32] Legs.
[40:20:36] Yeah, big body bends I have off my mind Big body escalate why like a homer
[40:20:38] When I pay the cash I put racks in the dump Too many hoes to come in by the double escalate I mean, when I rap, I get paid for this shit. Someone ducked off in LA with she bitch.
[40:20:51] I just do commercial, I didn't wear a mask.
[40:20:53] They put my arm on the bed and they pick.
[40:20:55] Serious, I don't even play by that money.
[40:20:57] Tell me you driving them back or something?
[40:20:59] Everybody gonna have something to say when I bust em'. can keep your shit all kinda ways how you want it
[40:21:02] Yeah, gave fifty racks to my momma and bought her a Benz
[40:21:04] I do not care about the cost
[40:21:06] Sure do ya know that she wanna FaceTime me all day
[40:21:08] But I pick up don't put her on call
[40:21:10] She's not questionin my loyalty niggas If I don't pick up, you call Oh my God! I'm wet handed, blue-prime niggas I was so tired this next time OH MY GOD!
[40:21:22] If you wanna put on my chain
[40:21:23] Zig a leave up not to use in the swing
[40:21:25] Whatever I tell her go jump in that water
[40:21:27] Where trust she gon' jump in that tank
[40:21:28] Big body bends I have off of my mind
[40:21:30] Big body escalate wild like a hummer
[40:21:31] When I pay the cash I put racks in the double
[40:21:34] Too many hoes that come in by the double
[40:21:36] We kickin' hoes out the hotel like karate
[40:21:38] My bitch bad she look like a Barbie
[40:21:40] Me and da baby like Jordan to Scotty
[40:21:42] I don't even rap I still keep just my hobbies Not me when I rap I get paid for this shit even out of ways I'm out. up on it get back on the girl who you arguing with gun in my hand when i'm parking my whip
[40:22:06] i said them business they started that i'm in the building
[40:22:11] me guarantee that you don't need a light jacket i was somewhere getting hit
[40:22:14] when the fight happened i heard the drop down, kid, I don't like rappers
[40:22:16] Too many like that
[40:22:17] Ain't no shame when you come fuck with me
[40:22:18] I ain't throwing no knife at shit
[40:22:20] Like a dealership
[40:22:20] Make sure you look out your window
[40:22:21] As soon as you pull up
[40:22:22] You gon' see that
[40:22:23] Big body bends, I have bop in my mind
[40:22:24] Big body escalate
[40:22:25] Wild like a Humble
[40:22:26] When I pay the cash
[40:22:27] I put racks in the devil
[40:22:28] Too many hoes
[40:22:29] To come in by the double
[40:22:29] We kickin' hoes out
[40:22:30] The hotel like karate
[40:22:31] My bitch bad
[40:22:32] She look like a Barbie
[40:22:33] Me and your baby
[40:22:34] Like Jordan or Scotty
[40:22:35] I don't even rap
[40:22:35] I still keep this a hobby
[40:22:36] Not me when I rap i get paid for this
[40:22:38] yeah someone dumped off in l.a with you big i just do commercial i didn't wear a mask
[40:22:41] and then put my arm around your plan serious i only play about that money tell me you driving
[40:22:46] them baby everybody gonna have something to say when
[40:22:48] i put him out keep your shit off how you want it here's your boy king charles back again one more
[40:22:53] time yeah you know what time it is the iceman's in the building!
[40:23:09] Damn, that was a good song
[40:23:11] there the agent
[40:23:14] That was acting I was actually Tom
[40:23:17] Y'all was floating on our home. Oh
[40:23:22] My god, y'all was slowin on that hoe.
[40:23:25] Yo, that was actually tough bro!
[40:23:30] Chat W's bro. Fucking Ws.
[40:23:31] What we got?
[40:23:32] We gotta watch!
[40:23:34] We watching!
[40:23:50] Excuse me. What are we watching?
[40:23:54] Let's see what we got.
[40:24:00] Oh my gosh, what do we got, what do we got, what do we got, what do we got, what do we got...
[40:24:02] Nico? Nico?
[40:24:03] Nico?
[40:24:15] This is the moment I tricked Mr Beast into giving me an extortionate amount of money and this is the story of how I did it because the only reason this was even possible
[40:24:18] is cause I'm running for Prime-
[40:24:20] FaZe? What you on, Faze or Nico?
[40:24:46] Nico back. the country and they usually represent a party. And whichever party wins the most areas win the entire election, and their leader becomes prime
[40:24:50] minister. But I don't want to fight another parties battle because all they do is
[40:24:54] lie so we have found a way to trick the system...
[40:24:56] Oh, my God! Look at his editor, bro!
[40:24:59] Yo, CB, you fucking suck!
[40:25:01] Yo, hold on. Let me call CB, bro.
[40:25:04] Hold on, bro. hold on bro. I'm going to use this system to allow Nick or Milana
[40:25:41] To run in multiple places across the country
[40:25:44] And save each place from our terrible government
[40:25:47] And i've done this by changing peoples names and training them to be just like me.
[40:25:51] And when we get enough votes as a collective,
[40:25:52] I will declare myself prime minister.
[40:25:54] And if I'm going to be prime minister,
[40:25:56] I want to be a good one.
[40:25:57] So I've decided to look at the areas our current prime minister has failed and i was shocked
[40:26:00] To see his party claim they'd get rid of homelessness by 2024
[40:26:04] And not only did they fail but homelessness is back on the rise
[40:26:07] My first order of business was to raise as much money as i could for
[40:26:09] Homeless homelessness so that
[40:26:10] could hopefully contribute towards a solution. How can you make a ridiculous
[40:26:14] amount of money quickly on YouTube? Well, the best answer would be Mr Beast! As
[40:26:19] I'm running for Prime Minister
[40:26:20] I had the opportunity to give him an offer he couldn't refuse.
[40:26:23] All I had to do was go and pay him a visit in America.
[40:26:28] Welcome.
[40:26:30] Hello Jimmy!
[40:26:31] Why am I here?
[40:26:32] Well,
[40:26:33] I'm running for Prime Minister of the United Kingdom.
[40:26:36] Oh this again?
[40:26:37] Yes well it was actually Mayer last time we've leveled it up and now I'm running for Prime Minister yeah.
[40:26:40] Oh really?
[40:26:41] There's no shot you win.
[40:26:42] Oh well I'm telling you now that I will win and I'll find a way.
[40:26:44] Okay.
[40:26:45] So I've got something which I'm gonna bring to the table in this briefcase.
[40:26:49] Oh boy.
[40:26:50] We have...
[40:26:52] Ooh okay! And I promise you Jimmy have Ooh, okay.
[40:26:54] And I promise you Jimmy
[40:26:55] if I win this election
[40:26:57] I will ban these chocolates unless
[40:27:00] you do what I'm going to ask of you
[40:27:02] You're blackmailing me
[40:27:03] No not a blackmail just more of a
[40:27:05] proposition. What do you want? The moment I make my announcement
[40:27:09] for the first 50 hours i'm gonna make as much money
[40:27:12] as I possibly can. Okay.
[40:27:15] Whatever I make,
[40:27:16] you have to match.
[40:27:19] What's in it for Feastables?
[40:27:20] They won't be banned from the United Kingdom.
[40:27:21] That's not enough.
[40:27:22] When you win,
[40:27:23] I want you
[40:27:24] to tell everyone
[40:27:25] to eat Feastables.
[40:27:26] You little pussy boy Jimmy.
[40:27:28] You think you can battle with me?
[40:27:32] That's not how this works!
[40:27:33] You can provide me all you want
[40:27:35] but that's what i'm bringing to the table.
[40:27:37] So when I win,
[40:27:38] you want me to tell people to eat vegetables?
[40:27:40] Agreed.
[40:27:42] OK, if I win the election...
[40:27:45] ..I will say that for you. I'm doing that for you.
[40:27:47] I'm doing this for you,
[40:27:49] I accept.
[40:27:50] Well done brother,
[40:27:51] I think you really made the right decision there.
[40:27:52] Don't forget what we agreed to.
[40:27:53] I won't forget, alright brother?
[40:27:56] Don't act like you didn't blackmail me.
[40:27:58] I didn't! It was a pleasure doing business with you Jimmy.
[40:28:00] When I'm president,
[40:28:01] I may or may not ban NDL clothing
[40:28:04] unless you keep your word.
[40:28:05] Okay, I will keep my word.
[40:28:06] We'll see.
[40:28:09] Wait is he going for president?
[40:28:11] Wait Jimmy went for President?
[40:28:13] Nooooooo
[40:28:15] He gonna be bleh
[40:28:17] Wait is he?
[40:28:24] Nah, Jack.
[40:28:24] He gonna be... Ha ha ha!
[40:28:30] Jack! Ha ha! ha ha ha
[40:28:34] We got it
[40:28:36] we've got jimmy in the palm of my hand
[40:28:38] The Jimmy Stimmy!
[40:28:41] We're about to make an extortionate amount
[40:28:43] of money, but 50 hours ain't a lot
[40:28:45] of time to make an extortionate amount
[40:28:47] of money so I was gonna need a plan
[40:28:49] See I have few friends that like to wager
[40:28:51] and for the 50 hours after my prime ministerial announcement
[40:28:53] I was going to be wagering each of them
[40:28:55] in all sorts of competitions
[40:28:57] For some serious money
[40:28:58] But little did they know
[40:28:59] I mapped it all out
[40:28:59] Nah seriously though If mr b became president chat that is the like
[40:29:05] like chat he is putting on the map with that do y'all understand
[40:29:10] that you understand how we probably could do?
[40:29:14] Like anybody who knows him could do?
[40:29:17] Oh my gosh!
[40:29:20] But what he would do...
[40:29:22] The only thing I couldn't work out how to swing my way
[40:29:23] was a prime bottle flipping match against Knowledge,
[40:29:25] but that's a problem for the future.
[40:29:27] Right now it is time to announce my campaign.
[40:29:31] Being president of a fucking country is like oh my god Oh
[40:29:42] My friends I've decided to run for prime minister and i'm going up against our current prime minister
[40:29:46] Rishi Sunak in the area of Richmond and plan to completely remove him from the political world. In the coming weeks I plan to show you that a man
[40:29:49] in children's glasses can do a better job than the horrific abysmal people running the
[40:29:53] country right now.
[40:29:55] I hope you guys know how seriously I'm taking this,
[40:29:57] it's time to put this country in my safe hands.
[40:30:01] July 4th make sure you vote for Niko Rishisonax
[40:30:05] You have no aura.
[40:30:06] It's time to go.
[40:30:08] We have no aura!
[40:30:10] Five, four, three...
[40:30:12] Ah it's posted!
[40:30:13] Perfect so now I'm gonna message Jimmy and I'm going to tell him 50 hours starts now.
[40:30:19] Mr Beast here we go
[40:30:21] And you know what?
[40:30:23] We have the perfect first challenge
[40:30:25] This challenge is a way for us to make the money to start wagering and the way we're doing that was using my
[40:30:29] Good friends at the beta squad so we do a lot of 10,000 pound challenges here at the base
[40:30:33] Well I usually win them
[40:30:35] So if I could set up one of these challenges without the guys realising it was me,
[40:30:38] It would be the easiest money I've ever made.
[40:30:40] So I hit up the Beta Squad channel manager to set up a shoot
[40:30:42] If you can set up a beta shoot and tell everyone that we got like a big brand deal
[40:30:47] I need a competition where I can win 10 grand and tell everyone that we've got like a big brand deal.
[40:30:48] I need a competition where I can win 10 grand
[40:30:50] from the beta account,
[40:30:52] but yeah, everyone needs to know it's a legit beta vid.
[40:30:57] Amazing! Thank you Siah, you're a real one!
[40:30:58] And bang the guys were locked in.
[40:31:00] With that being set up it was down to me to supply context so here's the plan...
[40:31:04] The video has been setup for the Beta Squad 2nd channel with a £10k prize
[40:31:07] which the guys thought would involve a brand deal for an incredible
[40:31:10] whole game which i made up and the video concept was simple speed eating who can eat
[40:31:15] the food the quickest then our chosen food was great so i went about swimming
[40:31:19] the challenge in my favour.
[40:31:20] I carefully measured each grape putting the large ones in one cup for the other guys
[40:31:24] And the smallest ones in another cup for me
[40:31:26] Meaning that I should walk away with a £10,000
[40:31:28] But if that's not enough
[40:31:29] I had a corrupt referee for safety who i briefed just before the
[40:31:33] shoot you need to penalize anyone who is more than one great fight so i want to do good stuff
[40:31:39] with this country and you'll be failing our country if i don't win but it is a fair match
[40:31:44] yeah and before the beta squad arrived i headed back outside and hid in our car to avoid suspicion
[40:31:49] then once everyone had arrived headed straight back in seemingly unaware of what was about to happen.
[40:31:54] And I was sure to let them know that we are running for Prime Minister!
[40:32:06] Chancel! I missed some throw. But it was time to get into the first money making match, speed eating the grapes. Camp main camp?
[40:32:07] Alright.
[40:32:09] This is the beta squad grape eater team.
[40:32:14] This is a group of peoplepe-Eating Contest, powered by The Incredible Hulk. The challenge is simple.
[40:32:16] We have 50 grapes each that we have to Hulk smash.
[40:32:18] The first person to complete it wins.
[40:32:20] Indeed they do, King Kenneth,
[40:32:22] but now it's time for RF to give you a little bit of an idea about what the game is all about. The first person to complete it wins. Indeed they do, King Kenneth.
[40:32:24] But now is time for RF to give these guys the rules.
[40:32:27] So there's not many rules.
[40:32:28] You're only allowed to eat one grape at a time
[40:32:30] and if I catch you eating more than one grape
[40:32:32] that's a three second penalty.
[40:32:34] I'll bring out the platters now you're all gonna
[40:32:35] open them at the same time in the moment it's opened they have to start eating well wait is
[40:32:38] there 50 in each one yeah there's five zero fifty confirmed confirmed chunks of strength an even
[40:32:43] playing field but behind my eyes i was already awaiting the
[40:32:46] realization on their faces when they see my tray compared to theirs. It was time to begin.
[40:32:50] Are you guys ready? Start, three, one...
[40:33:04] What the fuck?
[40:33:06] With AJ choking on the pressure I now only had Kenny and Chunks
[40:33:08] left to compete with.
[40:33:09] And Kenny started to notice the size of my grapes.
[40:33:12] These grapes are f***ing small!
[40:33:14] Look at this sliding room!
[40:33:15] I'm not having this.
[40:33:16] Look at these grapes!
[40:33:18] And now with Kenny wasting time complaining
[40:33:19] it was now down to Chunks who shockingly
[40:33:21] at this point was ahead of me.
[40:33:22] How am I so bad that I have everything in my favor
[40:33:24] and I might still lose?
[40:33:26] So I had to give the rough a nudge
[40:33:27] to keep it out
[40:33:34] chunks not stopping for the time penalty meant i have no time to catch up
[40:33:37] so the referee had no choice but to go to the extreme.
[40:33:39] Just 5 seconds! You did as well as Voss-
[40:33:42] 1... 2... you're about to get disqualified!
[40:33:45] 1... 2... 3...
[40:33:48] You got a disqualification! Two. What?
[40:33:50] You got a qualification!
[40:33:53] You can take three second penalty for you and you can stop.
[40:33:55] I'm done bro.
[40:33:57] How many?
[40:33:59] You had a penalty, but you weren't listening to it. But what's the penalty? Stop...
[40:34:00] Three seconds and you can't do nothing!
[40:34:02] I thought he said add in three seconds.
[40:34:07] That's not fair.
[40:34:08] Thanks to our non-corrupt ref,
[40:34:09] Chunks was then disqualified for not stopping every single time he was given a penalty.
[40:34:13] Meaning I was left to finish my final grape in peace.
[40:34:16] Why am I Mr Wee?
[40:34:17] That's cheating.
[40:34:19] I had betrayed my brothers. £10,000 had been snatched from their pockets and I felt awful but I knew I had to do this for my...
[40:35:11] Ah! ah uh uh Yo. Oh my God! oh my god Oh, fuck.
[40:35:31] Ah, fuck.
[40:35:51] Ah, fuck. This fucking, nah this is ass bro.
[40:35:53] What the fuck?
[40:35:58] What the fuck? Now that juke is your ass, man.
[40:36:02] What the fuck?
[40:36:06] ... what the
[40:36:13] oh my gosh nigga choked on apple juice, nigga you choking on my dick, nigga.
[40:36:28] Hold on let's get into this motherfucking Elden Ring nigga I want apple juice, nigga you choking on my dick, nigga.
[40:36:29] Hold on let's get into this motherfucking Elden Ring, nigga.
[40:36:35] Um...
[40:36:37] I'm gonna do shit, man.
[40:36:39] I don't wanna shit, man. Now I do what I want.
[40:36:41] Now I do what I want.
[40:36:43] Oh my god!
[40:36:47] Now I do what I want.
[40:36:58] Now I do what I want But everybody know I better Yeah, I'm better
[40:37:02] It don't matter
[40:37:04] If I get fatter
[40:37:06] Nowadays I'm on my haters
[40:37:08] They got sadder
[40:37:10] It's running longer' longer, different songwriting
[40:37:13] You're the producer
[40:37:15] But I can do anything and not a loser
[40:37:18] She got it right where the winner left that loser
[40:37:22] Talkin shit boy make me get my Ruger
[40:37:24] Yeah, I sell my Ruger
[40:37:26] All my niggas do the same
[40:37:28] Rocking them grills all the way to my two-turn
[40:37:31] Oh he cold? Well I swear that I'm cooler So my Don't know I'm a hot, man my way to the top Boy I don't do women
[40:37:45] No one can stop
[40:37:47] Turn that shit to a lot
[40:37:50] Always keep it 100
[40:37:52] Put that on my glass
[40:37:54] Now what 100. Put that on my glass.
[40:37:57] Now I want that glass.
[40:37:59] Come on, Jack.
[40:38:03] Lock in!
[40:38:05] Lock in
[40:38:09] Lock it boom
[40:38:13] Check lock the fuck in bro. Lock the fucking right now, bro Chat locked fuck in right now
[40:38:17] Boy
[40:38:18] Oh my god
[40:38:20] Lock the fuck in
[40:38:21] Come on bro
[40:38:22] We're closing in on 90 fucking hours
[40:38:25] Bro
[40:38:25] 90 fucking hours, bro.
[40:38:28] 90 fucking hours,
[40:38:28] bro.
[40:38:35] Let's go, y'all.
[40:39:22] Oh my god, we have 40 hours on this VOD? so so so I'm not sure if this is the best way to do it, but I think you can just go with what's in your inventory.
[40:40:45] I don't know why they're doing that here... so so so I'm not sure if you can see the so so I'm not sure if you can see it, but the game, rusty! Rusty, hold on.
[40:40:47] Let's save back into it, come on.
[40:40:51] Oh my fucking gosh...
[40:40:54] Again! again so so I'm not sure if you can see the so so so so Fuck!
[40:42:30] Fuck, fuck come on!
[40:42:39] Again! Come on.
[40:43:05] Come on, come on, come on, come on, come on. yeah he also feels like a dance so
[40:44:18] what the hell i did I can hear my dad. Thanks for watching! so so so oh my gosh, bro!
[40:44:22] Come on!
[40:44:27] I hate that I'm fucking two hit.
[40:44:30] I hate that I'm fucking two hit! I hate that i'm fucking too hit bro what the fuck
[40:45:50] oh so so so so so so Oh my gosh! Come on!
[40:45:55] Fuck, come on bro.
[40:45:59] I just need one good run, a good run in the second phase bro
[40:46:03] It's cheesy ass moves bro so cheap so so I'm not sure if you can see the so Come on!
[40:47:16] Help me!
[40:47:35] The fuck? Come on, man.
[40:47:40] What, Sonny?
[40:48:18] I'm sorry. so hmm I'm gonna go to the other side. AHHHHHH!
[40:48:22] Yeah, I got a question right?
[40:48:29] Bro does this bitch even do anything?
[40:48:35] Like it's on paper? It does?
[40:48:39] Like, on paper doesn't do anything.
[40:48:43] Let me see here... Like, all paper doesn't do anything.
[40:48:50] Retains not but the power to resist charms.
[40:48:53] What does that mean?
[40:48:54] Which charms?
[40:48:55] Which char- which? What's charms? What's charms, what's charms?
[40:48:59] Like the gold shit
[40:49:01] like gold and
[40:49:12] like Oh, the grab?
[40:49:13] Oh!
[40:49:14] Okay, okay, okay. I don't... Oh!
[40:50:32] Ugh! so so What? What? so what Whoa! Like, like... Oh my gosh! I'm so sorry.
[40:50:33] I was just trying to get a little bit of the Gosh!
[40:50:47] These big ass fucking attacks.
[40:51:48] ... How am I- uh I'm not sure if you can see the so I'm going to have to do this again. FUUUUCK!
[40:51:56] Oh my gosh come on I hate this nigga's attack though. so so so I'm not sure if you can see the so so so so so so so so so Oh! Oh!
[40:54:38] Oh!
[40:54:40] Oh!
[40:54:42] Oh!
[40:54:44] Oh!
[40:54:46] Oh! Oh!
[40:54:53] Like how the fuck do you...
[40:54:55] Holy shit!
[40:54:59] Fuck. Fuck! Oh my gosh, bro. How the fuck?
[40:58:25] BOOM so so I'm not sure if you can see the so so so so I'm not sure if you can see the so so so so so so so so so so I can run that. I can run that, I can run that, I can run that.
[40:58:30] That jump?
[40:58:31] I can run, I can run that. That jump, I can run. I can run that.
[40:58:32] I can run that.
[40:58:33] I can run that.
[40:58:34] That jump, I actually can run.
[40:58:35] I can run that.
[40:58:36] I can run that.
[40:58:37] I can run that.
[40:58:38] I can run that.
[40:58:39] I can run that.
[40:58:40] I can run that.
[40:58:41] I can run that.
[40:58:42] I can run that. I can run that. I can run that. I gotta remember bro bro. That shit eagles run.
[40:58:56] The rocks is running, bro.
[40:59:01] Just keep running the rocks. Keep running the rocks.
[40:59:03] Keep running the rocks. Keep running the rocks.
[40:59:06] Practice it in the first phase! Keep running, keep running, keep running.
[40:59:18] Keep running, keep running, keep running. Keep running, keep running.
[40:59:25] Oh! I'm dumb, I'm dumb, I'm dumb, I'm dumb.
[40:59:27] I'm buggin', I'm buggin'.
[40:59:28] I'm buggin'
[40:59:29] I'm dumb, what the fuck? so Keep running with rocks.
[40:59:59] Roll, roll run! I'm not sure if you can see it, but the Oh my fucking gosh.
[41:00:29] What the fuck?
[41:00:34] One shot.
[41:01:45] AHHHHHH so so so I'm not sure if you can see it, but the so so That was my bad. That was my bad!
[41:01:53] That was my bad!
[41:01:55] That was my fucking bad bro. Come on KC
[41:01:59] You know what he's doing bro, it's the same fucking combos with just extra lights
[41:02:03] The same combo with extra lights the
[41:02:05] same fucking shit you may not be able to see his shit but
[41:02:08] it's the same so I'm not sure if you can see the Oh, how does he keep catching me with that?
[41:02:57] Oh my gosh. How does he he catch me with that bro?
[41:03:02] Buff? What do you mean buff? I have buff flirty. I bought a buff 30 more boss what more can I add?
[41:03:26] Golden Vow, what the fuck is that? so I'm not sure if this is the best way to do it, but I think it's a good idea.
[41:03:59] I don't know what to say about that. so Yo, Sonny! I'm not gonna lie. I gotta find... No no no. Bro my flask got plus 10! Bro my flask got plus 10. I need plus 12, right?
[41:04:41] Bro, I need plus 12!
[41:04:46] Yo, what's a golden vow?
[41:04:48] Because I ain't gonna lie
[41:04:50] think about it bro
[41:04:51] if I had plus 12
[41:04:52] that probably would make me
[41:04:54] go to full bar
[41:04:54] when I need to I'm used to it not go to full bar when I need to.
[41:04:56] I'm used to it not going to full bar.
[41:04:58] That shit is a big game changer, bro.
[41:05:05] Boy, that shit's a big game changer bro.
[41:05:10] What do you do with Gordon Valdo?
[41:05:14] What is that?
[41:05:24] No, what does it do? What does it do?
[41:05:25] What does it do?
[41:05:27] I know. But what does it do? What does it do? I know, but what does it do?
[41:05:31] So what's it do?
[41:05:41] Wait. Wait, and what is it?
[41:05:43] Is it a... What is it?
[41:05:43] Is it a fucking
[41:05:47] um salesman? Is it a fucking...
[41:05:52] Tailman?
[41:05:56] Insonation, what the fuck is that?
[41:06:02] It's an insolation. What the fuck is an indication?
[41:06:10] Damn, how much?
[41:06:11] Okay wait hold on.
[41:06:12] How much?
[41:06:14] Damn.
[41:06:14] Fuck.
[41:06:21] Bro to get To fucking
[41:06:22] How much faith
[41:06:23] Do I need
[41:06:23] It's not magic
[41:06:29] But I'm on my
[41:06:29] 25
[41:06:30] Damn Boy that's a lot Of fucking wounds I don't know, 25. Damn!
[41:06:33] That's a lot of fucking moons! Yo, y'all confusing the fuck out of Magic.
[41:06:50] Y'all know this is not my first time playing no more right
[41:06:53] you can't trick me magic is literally like used to help for
[41:06:57] your like like magic weapons magic um
[41:07:02] magic fucking arm mana magic fucking spells like cast it on them niggas like
[41:07:08] that's faith bro
[41:07:13] it's not my first playthrough game.
[41:07:19] Wait, hold on!
[41:07:23] Yo I think- i need to get my
[41:07:25] yo can we search up the two rarest what do you need to um upgrade your
[41:07:31] look up hold on last
[41:08:03] would i need increase amount replenished by flies look up the most rare, how much do I need to get a plus 12, chat? Look up the two most...
[41:08:07] The two most rare, scare tears sick i mean sacred tears. Look at the two most sacred tears.
[41:08:39] Right, chat? The two rarest ones? Look at the two most sacred tears.
[41:08:41] Right, chat?
[41:08:41] The two rarest ones you think?
[41:08:43] I haven't got the rarest ones right?
[41:08:45] That's good to look up?
[41:08:47] I mean would give me the time?
[41:08:49] I don't know though.
[41:08:53] Which church haven't I been to?
[41:09:00] It's two more.
[41:09:04] I know for sure., where, where, where, where? Where?
[41:09:11] I wanna see how much of an increase that shit is.
[41:09:16] I'm sending pic-eye back... Wait, why the fuck is this shit possible on Twitter?
[41:09:56] Chat!
[41:09:57] Somebody said a boiled prawn
[41:09:59] and a boiled crab will work. Yes, bite them. Where they at?
[41:10:19] Yo why the fuck did she pop up on my sheet randomly?
[41:10:39] Wait you gotta buy those over and over again? Oh, they expensive. 600 damn.
[41:10:41] Show me the bottom of what? What? yo why did somebody send me straight 2,000 plus hits?
[41:11:13] Thorny Crack Tear plus Dexterity Not Crystal Tear.
[41:11:18] Jagged Crest Great Shield
[41:11:20] Talesman plus
[41:11:21] Claws Talesman
[41:11:24] plus Winged Sword
[41:11:25] Insignia Talesman
[41:11:27] plus Lord of Blood's
[41:11:29] Exolution This load of blood's exsolution.
[41:11:34] Flame, grant me strength.
[41:11:39] Thorny cracked with dexterity not crystal tear.
[41:11:49] Is that a WL?
[41:11:57] Dragon Crest, Great Shield, Tailman of the Claws, Tailman.
[41:12:00] Winged Sword Insignia Talesman.
[41:12:04] What is that?
[41:12:09] But what would I replace, though?... so okay um let me go to my dms real quick first one is here
[41:12:37] let me see
[41:12:44] where's that
[41:12:53] who the fuck is what map map is this? Oh, I'm buggin'.
[41:13:03] Man.
[41:13:43] ... wait chat hold on give me one second Let's search right here. gold braid i got it wait i think i should take off gold braid hmm
[41:13:56] like even if i get these sacred chairs because that might that might
[41:14:00] krypton speed tailsman what What is that? Damn, this mad tail's me bro.
[41:14:03] Shit!
[41:14:10] I'm gonna go get the fucking It is so early.
[41:14:20] That's my earliest I ever got on the game
[41:14:28] let's see What time is it we're at?
[41:14:38] Oh yeah, I definitely haven't been here. so so I'm going to go back and get the next one so Thanks for watching! Why that couldn't be the final boss, bro?
[41:15:52] Why that couldn't be the fucking final boss!
[41:16:10] Where is it? Oh i'm bugging what the
[41:16:27] fuck How do you hold this shit? Give me all that shit.
[41:16:30] Gimme all that shit.
[41:16:32] Gimme all of that shit.
[41:16:35] I need ALL THAT FUCKING SHIT! GIMME ALL OF THAT SHIT, YOU GOT IT?
[41:16:39] WHEEEEEEE uh so I'll go now.
[41:17:07] That was one.
[41:17:31] Oh, there's a chest? Where?
[41:17:36] Where? Oh...
[41:17:42] ... Dragonbolt Blessing.
[41:17:45] Shoutout to the next one!
[41:17:53] Oh, I'm going to have to go back and get that chat what's the next one
[41:17:57] kaya just whooped his ass oh my gosh
[41:18:03] cg set CG set. Try lake-facing cliff grace above Godric's castle.
[41:18:23] Where is Godric?
[41:18:41] Where? Where is that at lake facing cliff Oh shit, Guzzy. He just shitted on you.
[41:18:44] Yo, Guzzy.
[41:18:45] I'm not gonna lie, I would have taken that if it was you bro
[41:18:53] Yo guzzy, I'm not gonna lie
[41:18:57] Oh hold on guzzy, hold on guzzzy. Hold on, Guzzy. I might have this one.
[41:19:00] I think I have this one. I definitely do have this one. Right?
[41:19:06] Yeah, I have it.
[41:19:10] Hold on! Once the charges are discovered that means I most likely have it right?
[41:19:15] Okay Guzzy what you were saying?
[41:19:18] I don't remember picking you can pick that up.
[41:19:26] Can't you just automatically show once you discover land? I did it! I definitely picked it up.
[41:19:34] 100%.
[41:19:35] Wait, Guzzy!
[41:19:39] Where's that?
[41:19:42] Above Godji Castle.
[41:19:48] ...
[41:19:58] ... That was the one that you wanted me to send? Oh, that's the one he wanted?
[41:20:02] Okay. Oh, that was the one he wanted?
[41:20:03] Okay.
[41:20:07] Chad what do you think...
[41:20:09] Where.. What..
[41:20:12] Which church haven't I found?
[41:20:16] What's the church haven't I found?
[41:20:22] Freaky ass nigga here, 6-9 drop. Freaky ass Where's the last one?
[41:20:43] Top left of map. Where's the last one?
[41:20:48] Top left of Mal. Of map. Here?!
[41:20:54] At the bottom zoom in. top left snow oh it's a tough enough snow here Here?
[41:21:26] I'm missing one. Left. What?
[41:21:29] Like here?!
[41:21:33] Oh, this might be it huh?
[41:21:37] Oh that might be it!
[41:21:43] Wait what's the most amount of secret
[41:21:47] tears you can have? Twelve? Is it twelve?
[41:21:52] ...
[41:21:56] ...
[41:22:08] ... Yeah, I definitely go here.
[41:22:12] Nah, whoever said this might be a fucking genius. Man! I'm not going to let you get away with this.
[41:22:23] Look at that!
[41:22:27] Bro!
[41:22:30] I'm sorry, but I can't help it. That little ass fall. so Oh my god, what the fuck?
[41:24:09] Sonny you think I got this one? I'm not sure if you can see it, but the so what do i have to do Oh no, it's right here. It's right here sonny.
[41:24:12] W chat.
[41:24:13] W fucking chat!
[41:24:17] What the fuck?
[41:24:27] What the fuck?
[41:24:34] This bitch is big as fuck!
[41:24:41] Seek love?
[41:24:49] Okay let me Let me try to reserve her out. Okay, a little bit of Riz.
[41:25:14] Yeah, come on now. A little bit of Riz.
[41:25:24] Yeah, I'm missing her up. Hold on now.
[41:25:31] Sonny you need to send a photo. I Take it i took it out of the guy he's back so. Yo, where is that?
[41:26:50] What the fuck? He's set. Oh shit.
[41:26:55] . so And then where do I start from?
[41:27:24] Here?
[41:27:28] Here?
[41:27:32] Or... here or here Here we go, chat! Wait! There might be a golden seed there too, huh? I don't know. so Just keep swimming, just keep swimming Just keep swimming just keeps it up. Just keep swimming
[41:28:27] Just keep swimming just keep swimming just keep swimming just keep swimming
[41:28:33] It's going on my nigga?
[41:28:35] Oh fuck!
[41:28:39] Always hating, that's why your ass always gonna be in them graves nigga.
[41:28:42] I done got it out the hood nigga, I done got it out the mind nigga. You I done got it out the mind, nigga!
[41:28:46] You stay hatin', nigga, you gon' be a little gray forever,
[41:28:48] nigga!
[41:28:52] Always fuckin' hatin', bruh.
[41:29:00] Now them grave really sound like a hood though, chat On them graves
[41:29:01] Nah, I'ma start saying that
[41:29:05] On them graves, nigga On them graves nigga!
[41:29:07] On them graves nigga!
[41:29:11] Like that's a fire hood name
[41:29:13] on the grave nigga
[41:29:15] I'm big in them graves, bruh.
[41:29:18] Is anybody there?
[41:29:21] You might be interested in wrestling the great Kenishite!
[41:29:25] Who the fuck is that?
[41:29:27] ...and celebrating repudiator upon... is that You know... I know it's to my left.
[41:30:00] Crimson Crystal Tear.
[41:30:13] Oh, this is worse right? It restores half of total HP.
[41:30:15] What does that mean?
[41:30:17] If I'm below half it goes up.
[41:30:19] Yeah, that's ass.
[41:30:26] Hold on.
[41:30:27] I need the bathroom.
[41:30:58] I don't got a cake. hot dickhead man
[41:31:25] thinking they running my city weird I'm out. I these from anywhere i don't want christian view on my underwear
[41:31:46] be looking at me like i'm kind of weird be thinking they running my city where I just be holding the bench with my other hand. I brought my main bitch a cullinan, I brought my other mug bitch another bin
[41:31:49] Running these tracks like asses on linemen Throwing my hands in touch of the Stunnamans
[41:31:53] 1600s niggas from anywhere, item of Christian Dior on my underwear
[41:31:56] Piled on me and they cost me 100 grand years don't want no under armor that's from city
[41:32:00] gear be looking at me like i'm kind of weird niggas be thinking they running my
[41:32:02] city where I don't got a key. I get real hunky, or under the hockey man Shit real hunky, I make it through hunty then
[41:32:19] Instead of sexin' and manuphs for ugly men
[41:32:20] Ah ha, dickhead, dummy man
[41:32:22] I should be shootin' this track with one hand
[41:32:23] I should be holdin' a fence on my other hand
[41:32:25] I brought my main bitch, a color man
[41:32:27] I brought my upper low bitch, a little nuthin'
[41:32:28] Runnin' this track like I was a human Throwin' my hands in trash at the stutterman a columnist i'm a little city here be looking at me like i'm kind of weird be thinking they running my city I just be shooting this track with one hand
[41:32:55] I just be holding the bass in my other hand
[41:32:57] I put my main, bitch a color man
[41:32:58] I put my upper low pitch on another band
[41:33:00] Running these tracks like I'm the one in it
[41:33:01] Throwin' my hands, he turns into Stutterman
[41:33:03] 1600 of these niggas from anywhere
[41:33:04] I done went Christian Dior on my underwear
[41:33:06] Prada on me and they cost me 100 pair
[41:33:08] Don't want no other arm while that's still city here
[41:33:09] Niggas be lookin at me like I'm Connerwear
[41:33:11] Niggas be thinkin' be thinking they running my city where I just be shooting this trap with one hand, I just be holding the pants with my other My other lil bitch a little nugga been Runnin' these tracks like I was driving
[41:33:33] Throwin my hands, she turns to the Stunnaman
[41:33:34] Can't see none of these niggas from anywhere
[41:33:36] I done went Christian Dior in my underwear
[41:33:38] Pied on me and they cost me 100 pairs
[41:33:39] Goin' no under armada so city gear
[41:33:41] Niggas be lookin at me like I'm kinda weird
[41:33:42] Niggas be thinkin' they runnin kinda weird Niggas be thinking they running my city weird Oh my god, I just took a shit and that shit felt delightful.
[41:34:05] I'm sorry, I didn't need to know that. I know, I know. and that shit felt delightful.
[41:34:06] I'm sorry, I didn't need to know that I know, I know
[41:34:12] What's next?
[41:34:21] Should I go to the crap shit or no?
[41:34:34] ... Let me just try. Holy shit, bro this nigga needs to die, bro!
[41:34:37] I haven't had this much prep time, bro. This nigga needs to die, bro. I haven't had this much prep time,
[41:34:38] bro.
[41:34:40] Well, I feel like I've been prepping this...
[41:34:42] Like, bro, he the only boss that let me prep
[41:34:44] this much, bro.
[41:34:46] My prep time against Millenia was just one rune.
[41:34:49] He's really making me prep, like go out there and come back! Like what the fuck?
[41:34:58] Alright let's see the difference.
[41:35:02] Let's see the difference. okay so so so so so so so so so so Fuck! Fuck, fuck fuck fuck
[41:37:20] fuck i gotta i gotta hit oh my god god jump don't wanna jump jump Jump, hit. Jump, hit.
[41:37:30] Head on!
[41:37:32] Head on,
[41:37:33] bro.
[41:38:14] Oh! so so so Oh, bro.
[41:38:16] How does it keep catching me with that?
[41:38:18] How does it keep catching me with that fucking shit, bro?
[41:38:20] Oh my fucking god my nigga.. so uh Come on. so so so so so so so so so so so The Okay. What happened do this shit?
[41:41:47] So the crazy attack move...
[41:41:51] I gotta walk last minute and I just wait for it.
[41:41:56] Click that! Click clip that clip that clip that clip that clip that clip that pinning and clipping pinning
[41:41:59] could be a pinning clip That's his high security. Damn! so so so so so so so No! so I hate these attacks bro.
[41:44:38] I hate, I hate these attacks bro.
[41:44:42] I hate these these attacks bro
[41:45:27] i hate these attacks Nothing else, but the bro. I didn't buff, I didn't buff.
[41:45:30] I didn't buff bro
[41:45:34] Come on KC
[41:45:37] These rocks? Why do i always forget the ROCKS?
[41:45:41] Roll, roll, run!
[41:45:47] Roll, roll one, though. I'm not of you! I'm tired, I'm so tired of him bro.
[41:46:36] I'm tired of this nigga bro.
[41:46:43] But believe it or not bro
[41:46:45] I think I know these moves but
[41:46:47] I don't. Like the like
[41:46:49] oh my god the sword swinging
[41:46:51] be pissing me off!
[41:46:55] FUUCK! There's a certain sword swing that's pissin' me OFF! so so so I'm gonna lock him. so so so so so That's not fair bro
[41:48:56] That is not fair
[41:48:57] That is not fucking fair
[41:48:59] That's not fucking fair
[41:49:00] That's not fucking fair That's not fucking fair! That's not fucking fair, that's not fucking fair bro!
[41:49:04] Like fuck! so so so so so so so so so so so so I'm not sure if you can see the Oh, Oh my gosh, bro. so so so so so so I'm not sure if you can see the so so so so so so so I'm going to have to do this again. How do you dodge that?
[41:54:36] How do you dodge that?
[41:54:37] How do you dodge that fling attack, bro?
[41:54:40] Oh my fucking god i'm out of so so so so so so so so so so so
[41:56:48] large one That's one! Oh, bro.
[41:57:08] You can't run that.
[41:57:09] You can't run that.
[41:57:10] You can't run that.
[41:57:11] You can't run that, bro. I run that, you can't run that bro.
[41:57:12] I'm about to see right now.
[41:57:14] There's no way you could run that bro.
[41:57:17] Can't run that.
[41:57:21] You cannot run that, bro.
[41:57:27] Dodge one?
[41:57:31] Can I see like...
[41:57:35] Can I see somebody do it because I know what to do am I able to just
[41:57:38] Somebody doing real quick I hate these, I hate my chat.
[41:57:45] I hate my chat cause y'all literally just made me watch niggas beat the game and yeah still say no.
[41:57:50] Look I know what to do but yo I hate y'all niggas man.
[41:57:53] That shit be pissing me off bro.
[41:58:28] I think if you wanted me to do it impossible so I'm not sure if you can see the..
[41:58:33] . Like, bro.
[41:58:40] Like, goddamn, my nigga.
[41:58:41] I know the fucking move, bro!
[41:58:45] Like, damn, bro!
[41:58:46] This is not my first playthrough.
[41:58:47] Y'all niggas don't gotta be this fucking harsh bro.
[41:58:49] FUCK! so so Oh, fuck! me I don't get to watch one person.
[41:59:47] I don't know who I should watch.
[41:59:48] I don't get to watch one person.
[41:59:49] I just need to go that move i know
[41:59:53] what to do i know how to dodge that move but god
[41:59:56] damn my nigga I've been fighting this nigga for 50 hours, going on 60 HF
[42:00:16] bro Faze Sway the Lime
[42:00:18] I wanna run content bro
[42:00:25] im not ch- oh my f**k I'm not...
[42:00:33] I hate y'all niggas bro. This shit is so fucking annoying, like damn! Y'all niggas are not being logical, bro.
[42:00:35] It's not like I'm searching up how to do it.
[42:00:38] I'm just literally just seeing...
[42:00:40] Bro, I'm looking at a move that I've already accomplished!
[42:00:46] Boy, y'all niggas acting like this shit is my fucking
[42:00:48] first playthrough, my nigga.
[42:00:52] I swear to God y'all niggas do not be on niggas dicks bro
[42:00:54] just because it's me bro it's because of me every time
[42:00:58] bro just cause it's kc bro it's casey bro it's cuz it's kc bro you gotta do everything the
[42:01:04] perfect way he had to do this you he gotta do that. He gotta stay,
[42:01:07] he gotta struggle. He gotta go through all these
[42:01:09] hours after knowing every fucking combo.
[42:01:12] He can't watch a certain amount because
[42:01:13] he gotta see how everything is
[42:01:15] la-la-la-la-la-la cause it's KC bro. Yeah I know bro. see how everything is. La, la, la, la, la, la
[42:01:17] because it's KC bro.
[42:01:18] Yeah I know bro.
[42:01:19] I know bro.
[42:01:21] Shit is so fucking dumb.
[42:01:22] So dumb.
[42:01:23] So dumb.
[42:01:24] I understand first playthroughs
[42:01:26] I understand all that shit
[42:01:27] but god damn bro that shit is so fucking stupid.
[42:01:30] Fuck this fucking dumb ass fucking game!
[42:01:32] Never playin' this shit a fuckin' again!
[42:01:34] Never bro!
[42:01:35] Shit's fucking ruined my fucking life.
[42:01:44] Living my fucking life, my nigga. Fucking li in hell.
[42:01:51] This fucking dumb ass,
[42:01:52] fucking final boss bro.
[42:01:54] Been fighting this nigga for
[42:01:55] fucking 60 hours my nigga!
[42:01:59] Sixty bro! This thing is fucking annoying. Had me running around the whole fucking map, I changed my whole fucking weapons! so so I'm not sure if you can see the so so so so so I'm not sure if you can see the This is a dumbass fucking boss bro.
[42:03:51] It's just so dumb, this shit is so fucking stupid.
[42:03:55] No boss should take this long!
[42:03:58] No ball should take this fucking long, oh my fucking god I'm out of spads bro. uh so so so so so I'm not sure if this is the best way to do it, but I think you can get a lot of points for that.
[42:05:19] I don't know what's going on here... so so so I'm not going to let you get away with this. You can't run that! You can't run it!
[42:06:06] God, I keep on telling you.
[42:06:10] You cannot run that!
[42:06:14] You can't run that! You can't run that! AHHHHH!
[42:06:17] YOU CANNOT RUN THAT!
[42:06:19] You can't!
[42:06:24] Run it! Exit out!
[42:06:58] Exit! Punch it up! Throw away throw it away throw the away bro so oh my gosh dude is this tellspin to roll faster to roll fast so This shit's pissing me off, bro. Yeah.
[42:07:35] Dog beat the boss, but this shit is fucking hard up!
[42:07:39] It's not hard it's just like...
[42:08:00] AHHHHHH!!!! it's not hard as you say oh my gosh bro it's not hard as- bro! It's not hard as-
[42:08:04] It's just a fucking skill issue, BRO!!!
[42:08:08] Nigga put on fucking- fucking skill matchmaking and what the heck if you ask?
[42:08:14] Make the boss a certain type.
[42:08:16] Make this shit matchmaking, bro!
[42:08:20] I got a life, bro!
[42:08:21] I got a family!
[42:08:23] I got friends, bro! I got a family. I got friends, bro!
[42:08:25] I got places to be, things to see!
[42:08:29] I can't think
[42:08:38] y'all understand, boy.
[42:08:40] I got places to be
[42:08:42] and things to see like
[42:08:43] truthfully
[42:08:44] like chatfully like chat
[42:08:46] like bro I'm missing out on
[42:08:48] so much shit
[42:08:49] every time a day go by
[42:08:52] I have to miss out on something or push
[42:08:54] something back
[42:08:55] I need I mean out on something or push something back i need I don't think y'all understand
[42:09:10] what's going on, bro.
[42:09:12] No, this is a problem.
[42:09:14] This is actually a problem, bro.
[42:09:16] It's not like last time. It's not like last time this is different because last time I'm going through
[42:09:24] This time
[42:09:26] My last it's not my just the ball to get on my last boss it's not like this is the ball to get
[42:09:29] to the last boss no this is the last one and then i'm free
[42:09:33] to go i need to kick down one more door bro
[42:09:38] one more fucking door bro! One more fucking door!
[42:09:43] One more door
[42:09:47] One more fucking door One more fucking door. One more fucking door.
[42:09:54] One more fucking door!
[42:11:06] Come on! come on so One more time! I'm going to try and get the bomb. so I'm going to have to do this one more time.
[42:12:19] Take it! Take it, Patrick! take it Here we go! I'm on the right side of that hill. I'm going to get you! so Hold on! I don't even know what I did.
[42:12:20] No, I'm watching a video now.
[42:12:21] Can I watch the video now?
[42:12:23] I know how to do it now!
[42:12:25] Okay, roll!
[42:12:26] Roll!
[42:12:27] Woo-hoo!
[42:12:28] Whoa! Roll! Whoa! Whoa!
[42:12:30] Roll! Whoa!
[42:12:32] Like fuck!
[42:12:38] You never did that before?
[42:12:39] Are you, are we lying now? Are we lying now?
[42:12:41] Are we lying?
[42:12:43] Chet, are we lying?
[42:13:05] Don't jump though i have to jump Who the fuck is this? Let me guess.
[42:13:06] Let me solve on her?
[42:13:07] She's throwing up, trying boy.
[42:13:08] Bunker on Sean.
[42:13:09] What's that?
[42:13:10] I don't know what she doing.
[42:13:11] I'm not sure. I'm just gonna go with it. I'm just gonna go with it. Join up. Join book.
[42:13:13] Bunker on short.
[42:13:15] What the fuck does that say?
[42:13:19] What does that say?
[42:13:22] Home ball? Really? Wait, who's on ball?
[42:13:37] Wait, didn't I shout out
[42:13:39] On Ball?
[42:13:42] His name sounds familiar.
[42:13:45] I think I see some of his shit
[42:13:51] Did not shot him out? Yeah, I did! I saw some of his shit
[42:14:13] Wait he's a dope? Better than Lemmy Solar?! the dope better than let me solar I mean it's tough though because you can't oh wait you can see my controller but you can't ill as well Jack but you can even tell ew, Xbox? Well I don't know.
[42:14:16] Check but you couldn't even tell, wait hold on.
[42:14:18] Wait I got a question.
[42:14:19] Check you can't even tell if somebody's nice right
[42:14:21] because they're just gonna upload a perfect clip?
[42:14:26] I'm not cheating.
[42:14:27] I know how to do every move.
[42:14:28] That's what a guy oughta do.
[42:14:29] And Chad, if anybody feels
[42:14:30] a little bit of weight
[42:14:30] please let them know that bro.
[42:14:33] Wait.
[42:14:34] Look at his health.
[42:14:35] Wait.
[42:14:36] Wait. Wait! Wait!
[42:14:42] Is he nice?
[42:14:46] Wait, what weapon is this?!
[42:14:51] I will literally jump out my fucking window if he...
[42:15:33] Is he fighting with a fucking toothpick? so so Oh, wait.
[42:15:35] See that's fake, that's fake because I can't do that.
[42:15:36] That's fake, that's fake.
[42:15:38] That's fake! He was damn it to me. How do you do that?
[42:15:57] How do you do that?
[42:15:59] How does it get staggered?
[42:16:01] To me, it's the fact I appreciate it.
[42:16:04] What the fuck is a parry?
[42:16:16] A parry is counter-block on an attack right? a carry is when you counter block the same exact time he attacks.
[42:16:21] Well when you hit so I know that, I think that's a good idea.
[42:17:13] I don't know what you're talking about, but I'll try to get out of here before he gets me. I can't see him. so The I'm not sure if you can see it, but the You do just like this. Wait, what am I spoiling?
[42:18:05] Chat, what am I spoiling?
[42:18:06] No.
[42:18:06] Okay.
[42:18:07] What am I spoiling?
[42:18:09] WHAT AM I SPOILING?!
[42:18:12] SHUT THE FUCK UP!
[42:18:14] I'VE SEEN EVERYTHING!
[42:18:15] I'VE BEEN FIGHTING IT FOR 55
[42:18:17] FUCKING
[42:18:18] HOURS!!! Earth! I was bro. Oh, let's see that Wow okay
[42:18:38] 55 fucking hours my nigga
[42:18:55] Oh my New move?
[42:18:56] I seen that.
[42:18:58] What the fuck?
[42:19:01] Oh, bro, y'all niggas is fucking tripping, bro.
[42:19:03] Y'all niggas is tweaking, gang. Y'all niggas some new niggas on the block, bro. Y'all tweiggas is tweaking gang. Y'all nigga some new niggas on the block bro, y'all tweaking bro! Okay, so how do I do this shit? So the crazy attack move, I gotta walk last minute and I gotta just wait for it.
[42:19:30] Aw, cut that, cut that, cut that.
[42:19:32] Cut that, cut that, cut that, cut that, cut that, click that. Pin it.
[42:19:40] Look, I'm going to predict the move before it happens, right? Look.
[42:19:42] Dodge in.
[42:19:45] Dodge in.
[42:19:47] Oh, this is the crazy one!
[42:19:49] Oh, that's a crazy move! Hold on...
[42:19:53] He makes like a fucking
[42:19:55] cross! He makes like a fucking cross.
[42:19:59] So what is that? What is that?
[42:20:03] Is that dodge left, dodge right?
[42:20:07] That might be dodging.
[42:20:09] Dodging, dodging
[42:20:11] Wait
[42:20:13] Dodging
[42:20:17] What is that?
[42:20:19] Dodge...wait
[42:20:24] Cross
[42:20:28] I don't feel it Fuck, dodge How do you feel?
[42:20:30] Of course. Dodging, dodging...
[42:20:32] Of course
[42:20:36] Dodging, dodging
[42:20:38] Then it's relaxed It's dodging, dodging, relax.
[42:20:45] Dodging, dodging...
[42:20:48] Dodging, dodging, relax.
[42:20:51] Dodging, dodging, dodging, relax. I'm watching you. I'm watching you. I'm watching you.
[42:20:55] What the fuck am i lo-
[42:20:57] WHAT AM I WATCHING?!
[42:21:02] What am I watchi- I'm singing! One, one, one.
[42:21:10] Of course. Dodging, dodging, relax, dodging, dodging, dodging, dodging. Those four dodges.
[42:21:14] Dodging, dodging.
[42:21:16] Dodging, dodging, dodging, dodging.
[42:21:20] Five! Oh my god.
[42:21:22] Dodging... Dodging... 5, oh my god
[42:21:29] Is that 6 hits? 1 2 3 One, two.
[42:21:34] One, two, three, four, five, six.
[42:21:38] That's six right?
[42:22:49] One, two... 1, 2, 3, 4, 5, 6, 7. one two three four five six seven I'm going to try and get the right so so What? Catch him, catch him, catch him, catch him, catch him Catch him, catch him
[42:22:51] Catch him
[42:22:57] What? Catch him, catch him, catch him I'm not sure if this is the right way to do it, but I think that's a good idea.
[42:23:01] I don't know what you're talking about.
[42:23:07] I'll try to get ahead and do it. Wait what? I counted five or six I can just spam roll in? so Bro, am I
[42:24:22] creaking? Look, goes. It's literally chat
[42:24:32] Tell me. One...
[42:24:36] Two...
[42:24:41] Three... 3
[42:24:46] Right?
[42:24:50] 4
[42:24:54] Right?
[42:25:02] Five.
[42:25:06] Six.
[42:25:08] It's six!
[42:25:11] It's six!
[42:25:14] No, it's not! Six
[42:25:19] Not a beam
[42:25:26] The vegan you doctor for sound not little camp if you thought the first time not true but Come on, bro. Let's get back in it. One more door.
[42:26:21] Oh my god, chat. this is just so fucking annoying bro
[42:26:29] It's like I'm not even getting, like... Y'all won't believe y'all..
[42:26:55] .
[42:27:00] .. so so I'm not sure if this is the right way to go.
[42:27:43] I don't know what's going on here, but it looks like there are some enemies in that area. Somebody said
[42:27:58] Chat somebody say use Millennium Rune you get heals on it when you have been hit. Use Pearl Drake 3 Tailorsmen, Dragon Crest Great Shield Tailorsman and Golden Braid in a ClawTalesman.
[42:28:11] Use Opaline Hard Tear
[42:28:13] the tear that increases stance
[42:28:15] breaking damage
[42:28:22] Consider switching a heavier sword and put an ash of war on it and use bleed
[42:28:29] infinity so you can still get blood build ups. If you use those talismans and the physic, I said you can tank that mega light circle attack
[42:28:36] And instantly start hitting building bleed on him
[42:28:41] Is that a W? Okay, so we might have to go sign up then.
[42:29:27] How do you put out the talesman shit? talisman talisman talisman, talisman. Do I have a talisman? Imma name my child a talisman.
[42:29:29] Talisman come here talisman
[42:29:31] Ew they gonna bully that n***a
[42:29:40] yo who should i be for dreamcon chat
[42:29:44] should I stream at DreamCon?
[42:29:47] I ain't gonna lie,
[42:29:48] DreamCon be getting crazy, bro.
[42:29:50] I can't like do shit.
[42:29:51] Telling you about DreamCon,
[42:30:01] I can't even do shit, bro. No! I'm not being redone. so I'm not sure if this is the best way to do it, but I think you can just go with what's in your inventory.
[42:30:33] I don't know why they're doing that here... so so What are you doing? What are you doing? Oh my god, bad run!
[42:31:24] Bad run!!! I'm not sure if you can see the so That's my fuck up!
[42:32:04] How do I fix that?
[42:32:07] I did not side to side but god damn bro.
[42:32:10] Goddamn! so That's my fuck up bro
[42:32:39] Okay we can run on those
[42:32:40] Okay we can run on those
[42:32:42] That's not bad
[42:32:43] We can just keep running
[42:32:43] On those backwards
[42:32:44] Backwards
[42:32:45] Backwards We can run on those We can run on those We keep running on those backwards backwards backwards you can run
[42:32:46] to nose with one of those we could run in those backwards you go one of those
[42:32:48] you can run on those people run on the rocks right if i'm running the rocks
[42:32:52] the rocks at the spam even one of those
[42:32:54] right even one of those right?
[42:33:01] All the way back, all the way back. Oh my god, I'm at 988 bro. so so That's my problem.
[42:33:40] I don't know. so That's not a problem though. Oh my fucking gosh. Lord, lord, LORD! I'm going to go ahead and do that. It's fine.
[42:34:50] It's fine.
[42:34:57] I think I just got two of them
[42:36:20] Wow that's crazy so so oh so so so what I'm not sure if this is the best way to do it, but I think you can get a lot of points for that.
[42:36:31] I don't know what's going on here... That worked, bro. Oh my god! Why'd they do that?
[42:36:36] I don't know. oh my god so so Set me free, bro.
[42:37:22] I wanna be free i want to be free bro god damn bro
[42:37:31] free me bro Free me, bro!
[42:37:38] Free me, bro.
[42:37:41] Free me, bro?
[42:37:45] Free me, bro Free me, bro
[42:37:55] Free me!
[42:37:58] Free me!
[42:38:01] I can start your body
[42:38:04] This doesn't work When you walk in your body way too tough Be free, be free, man Be free, be free, be free
[42:38:28] Be free, be free, be free
[42:38:32] I wasn't a chick
[42:38:33] And I showed you all of my tricks
[42:38:35] I know you was there
[42:38:36] I would fill up in the seven You would fill up in the seven
[42:38:38] and you would fill up in the six
[42:38:40] big money shit
[42:38:42] i grew up on a bridge
[42:38:44] grew up in an x
[42:38:46] feeling uncomfortable still can't even talk to my friends I need your enemy girl, I'm on your wing
[42:38:59] Let's do it over again
[42:39:02] You started your violence
[42:39:04] Still hasn't worked
[42:39:06] You walk in this party
[42:39:08] Like somebody hurt you
[42:39:10] Cause you need me back and cross over
[42:39:13] You don't have to play two girls from now
[42:39:16] I don't deserve you
[42:39:18] Be free, be free, be free Free me!
[42:39:35] Free me! i want you to hurt me one is Christian Lubin's in rock and Vasa perfume
[42:40:14] Way too good for me
[42:40:16] I don't deserve you
[42:40:18] Be free, be free, be free
[42:40:22] Be free, be free, be free me I ain't gonna lie, one thing that I learned chat.
[42:40:49] One thing about I learned about Elden Ring.
[42:40:57] At times when you keep failing,
[42:40:59] You need to become...
[42:41:00] You cannot go in there with the same strategy.
[42:41:04] You're obviously missing something
[42:41:07] It's obvious. You're obviously missing something
[42:41:11] with oh
[42:41:14] My god, I think that's the trust this guy right here, Chad. You think I should trust this guy?
[42:41:18] Use Millennia's Rune to get heals on it
[42:41:21] when you have been hit.
[42:41:23] Use Pearl Drake Three-Tailsman
[42:41:25] Dragon Crest Great Shield-Tailsman Golden Braid... tailsman, dragon crest great shield
[42:41:28] talesmen golden braid claw
[42:41:31] talesmen.
[42:41:36] Use opaline hardar and the tear that increases stance breaking damage. Consider switching a heavier sword and put on Ash of War on it and use bleed infinity so you can still get
[42:41:55] blood build ups if you use those talesmen in the physic i said you can tank that mega light circle attack
[42:42:04] and instantly start hitting building bleed on him talisman. Okay, I don't know.
[42:42:29] Somebody sent me that on Twitter, bro.
[42:42:34] They sent me that on Twitter bro
[42:42:40] so I understand that so let's copy and paste it and send it to Sonny?
[42:42:45] And he said, Kai trust me.
[42:42:48] Use Golden Vow and Flame Grant Me Strength
[42:43:19] It gives 25% damage increase and 15% damage reduction. and chat and it was still for my build What? Oh my god.
[42:43:23] This is so fucking hard. 25 faith.
[42:43:40] So what do I sacrifice, chat?
[42:43:44] What do I sacrifice in order to put up my faith?
[42:43:53] Or do i just have to like literally just farm that shit 92.
[42:44:23] So you know how long it's gonna take to farm, bro? I don't know.. It's not magic.
[42:44:48] No, it's not. Oh my gosh bro...
[42:44:53] Chat farming with chat!
[42:44:57] Chat that shit gonna take me like
[42:45:02] twigs to five to depreciate it bought a booster s one two three i need 10 million
[42:45:08] runes bro so do y'all know that i need 10 million moons But what would I sacrifice for a chat?
[42:45:30] Bro, 25? The strength needs to be at 30? No, Arcade House bleed. Okay, alright.
[42:46:06] Sunny! Why does this piss me the fuck off bro?
[42:46:10] This is-this is pissing me...the fuck...off bro. oh Okay, chat.
[42:46:35] So we're confirming a remodel just our whole a whole remodel.. chat because i okay this is why fle like we should pick up a whole model right?
[42:47:23] If I'm not going down
[42:47:25] Chad at this point everybody who you've
[42:47:27] watched
[42:47:29] would they start to consistently get below halfway?
[42:47:31] And their first bleed and shit? Yes?
[42:47:46] Like, at this point.
[42:48:02] Yes! But at this point in one sitting, bro who's still in one sitting and struggling? Like, who?
[42:48:04] In one sitting.
[42:48:06] I think I'm the only nigga!
[42:48:11] But if you give another nigga this much amount of time, they will beat it. They're beating it.
[42:48:15] They were beating it.
[42:48:16] They're beating it.
[42:48:17] They're beating it.
[42:48:18] They're beating it.
[42:48:19] They're beating it!
[42:48:20] I'm the only dumb fuck.
[42:48:28] Ludwig beat it!
[42:48:32] Bro, like I'm thinking...
[42:48:34] Like I feel like Ludwig was in the same boat as me.
[42:48:43] I feel like he was in the same boat as me and then he just had probably better tailsman.
[42:49:06] Yeah. just have better tailsman Sonny, I sent you the shit bro I'm stressing I can't fucking take
[42:49:08] this shit I can't take this shit. It's pissing me off, bro.
[42:49:32] Sonny did you send it to me?
[42:49:38] I sent it to me?
[42:49:39] I sent it to you bro.
[42:49:43] Wait, I never sent it to you? Aw fuck! It's pissing me off.
[42:49:52] I've been in this bitch for fucking almost 60 goddamn hours, bro!
[42:50:00] You see him crying and shit.
[42:50:01] Fine, do it all this time.
[42:50:02] But is that hard as fuck, man?
[42:50:03] Do it all this time.
[42:50:04] Yeah, you got to lock me in here real motherfucking game.
[42:50:05] And then you're like...
[42:50:06] Bro!
[42:50:07] How many hours?
[42:50:08] On him alone?
[42:50:09] Yeah.
[42:50:10] See how long he can take? Yeah. He's been doing it for a while now. You're like... How many hours?
[42:50:11] On him alone?
[42:50:13] Almost 60!
[42:50:15] But look, at some point you gotta sit back and think
[42:50:18] Is it me? Right?
[42:50:20] I think it i think
[42:50:22] i think it's me it might be you because 60. i ain't even
[42:50:27] dude guess what dumb i did some dumb shit
[42:50:29] what my bill was so ass that I like went back and like restarted this shit to try to find a
[42:50:39] bill.
[42:50:40] And I think, fuck!
[42:50:42] Hi, how you doing yeah yeah Thanks for having me. Yeah, yeah, for sure. So somebody told me you were having some outbursts so I came to chat with you and see if I could be a pal.
[42:50:56] Who got me a therapist my nigga?
[42:50:58] You're a therapist?
[42:50:59] Hi, yep, I'm Aubrey Ebony.
[42:51:00] They call me the model counselor.
[42:51:01] I counsel models, creatives, YouTubers.
[42:51:05] And today Kai!
[42:51:07] Hi!
[42:51:09] What?
[42:51:11] I...
[42:51:13] Sheep!
[42:51:15] Really big beef though. I see Really did
[42:51:25] Oh Hold on, let me show you something. It's good. Oh my gosh!
[42:51:27] You got this. Breathe. That's the first step.
[42:51:30] Okay. Here ya go.
[42:51:33] I'll be back. I'll be back.
[42:51:35] Alright. This is a machine gun. I'll be back. I'll be back. Nice to meet you, Aubrey.
[42:51:36] Hi, man.
[42:51:38] This is my chair?
[42:51:39] Come back right after this!
[42:51:41] Alright.
[42:51:42] Hi, Ty.
[42:51:43] Wait who got me a therapist?!
[42:51:44] It's a secret.
[42:51:45] A little bird told me to come chat with you.
[42:51:46] Okay.
[42:51:48] Hi Aubrey, how are you?
[42:51:51] So chat with me why do you think somebody would throw me in?
[42:52:00] Cause I'm on this fucking dumbass game called Outer Ring and I've been on the last ball for like 50 fucking hours.
[42:52:04] Okay, so you're having a hard time getting to the final point? How close are you?
[42:52:07] This is the last one! Like literally he's the only one in my way!
[42:52:08] Okay, so what's your game plan to get
[42:52:09] to the final and win this thing?
[42:52:12] I gotta beat him.
[42:52:13] Well we better go out
[42:52:14] and just try to get like more,
[42:52:17] More like... I don't know, like more like i don't know like more like talisman
[42:52:21] talismans and runes and like a whole bunch of new
[42:52:23] new okay let's still want the game for a sec just for one sec how are you
[42:52:28] how are you ass How are YOU, you?
[42:52:30] Ass. I wanna get off!
[42:52:32] Look how long I've been here. I've been here for 92 hours.
[42:52:34] Yeah, 92 hours.
[42:52:36] So how are you taking care of you while
[42:52:38] you're navigating this game non-stop? I'm eating.
[42:52:41] What are you eating?
[42:52:44] Healthy foods,
[42:52:45] I hope. Steak.
[42:52:47] Okay.
[42:52:49] Mashed potatoes, broccoli...
[42:52:50] Okay so you're getting your protein and veggies.
[42:52:53] Honey hot wings from American Deli.
[42:52:55] From American Deli!
[42:52:58] Philly cheesesteak.
[42:52:59] So you are eating.
[42:53:00] How's your rest
[42:53:02] my arrest is pretty good no i'm resting like six seven hours
[42:53:05] okay yeah they can't hear you come closer hold on chat y'all get here
[42:53:11] hold up my phone Y'all can't hear? Hold up, my fault.
[42:53:18] Better? You guys hear me now?
[42:53:21] Okay so you're sleeping six to seven hours a day. You felt yeah
[42:53:25] So your body is good. You're just stressed about this game. Yeah, and you've been in it 50 90
[42:53:30] 92 hours
[42:53:33] Okay now I see it.
[42:53:34] Okay and this is a 100 hour livestream we're hoping to beat the game in the next 8 hours
[42:53:37] Yeah but like I wanna-I really just want to beat it NOW
[42:53:41] Yeah
[42:53:45] No but I want it!
[42:53:46] Like I need it!
[42:53:47] You do need it and you will do it.
[42:53:48] But I also think that you might need to take a step back, take a deep breath for a sec for me, do you mind? Give me another one. One more.
[42:54:04] Yeah now I know sometimes we want things immediately and instantly,
[42:54:06] And you're gonna win this game! You won a lot of games right?
[42:54:08] Do you feel confident that you can beat this game?
[42:54:11] Yeah because I beat the last one
[42:54:13] You did, you did beat the last one so you know you're going to beat this one right?
[42:54:17] Conflict You did. You did beat the last one, so you know you're going to beat this one right?
[42:54:20] Confidence though and you have to speak up. Yeah I'm gonna beat it yeah
[42:54:21] So your having a little bit of stressful time now
[42:54:23] Let's put a pause since we are at pause
[42:54:26] What makes you happy that's not the game
[42:54:29] maybe two things does make me more be happy
[42:54:34] grass like outside like building with be able to touch it. Outside environment,
[42:54:38] grass, give me one more. And my
[42:54:40] friends like I have
[42:54:42] a whole...I have friends and stuff outside
[42:54:44] So you're ready to get off this game
[42:54:46] so you can get back into your friends,
[42:54:48] get back into the world.
[42:54:49] Yes!
[42:54:52] And the thing is, everything I'm going on, right?
[42:54:54] There's things that I have scheduled like I want to be able to do in life
[42:54:55] and I can't do it.
[42:54:57] So like the thing that stressed me out is that this bitch ass
[42:55:00] Fucking fuck and stopping me from enjoying my life
[42:55:04] He's preventing me but going outside and having fun
[42:55:11] So going outside and having fun no i definitely understand so i just don't know how to how can i get past them
[42:55:14] and how could i like like i want to just live
[42:55:17] i can't be here any longer like but it was cool
[42:55:20] It's not even like it was like I'm going through the game and his lore
[42:55:24] And I finally ordered them to stop right if I've been on the last boss
[42:55:28] for the past 60 hours of my life that I can't get back and I'm trying everything. I want to get a new weapon
[42:55:35] I went to
[42:55:37] Upgrade a new stuff like my old dexterity my arcane
[42:55:40] um, I dropped my fave
[42:55:42] I got more strength like I've done so much to change my whole shape
[42:55:46] I even dropped my katanas that I beat from the first playthrough
[42:55:50] And what was the closest you got to beating this?
[42:55:53] About, like right before his name on the bar is like right before his name I'd probably
[42:55:59] say like 45% left in his hug bar.
[42:56:01] So 45% is as close as you've gotten?
[42:56:04] Yeah.
[42:56:04] Okay, let's go to rest for a sec.
[42:56:06] Oh, I just got scared.
[42:56:08] Let's see what Don again.
[42:56:09] Oh my God, don't get scared.
[42:56:10] There's success in this room
[42:56:11] and the people watching.
[42:56:12] Okay, so close your eyes.
[42:56:14] Really relax, breathe again for me
[42:56:17] And get to that 45% again.
[42:56:18] See yourself making it to that 45%.
[42:56:20] I don't see myself.
[42:56:22] Okay?
[42:56:23] Let's remember what you did the first
[42:56:25] last time you did to get to that 45%
[42:56:27] so that is how you are going to see yourself
[42:56:29] remember what you were doing
[42:56:31] the game, the moments
[42:56:33] the things you were feeling
[42:56:33] all the moves you were making right the moves you were making. All of the things right up
[42:56:35] to when we got to that 45%. Get there.
[42:56:37] Get there again.
[42:56:39] Okay? Because if you can get there
[42:56:41] then we can get it all the way where it has to go. Right?
[42:56:43] It's just a percentage thing. You're trying to get them down the zero percent, right?
[42:56:46] You got into 45 which means you've got them already past halfway
[42:56:50] which means you can do the second half but I need you to stay in that very
[42:56:53] resilient energy because you have a very resilient energy about
[42:56:56] yourself see yourself again hitting that 45.
[42:56:59] say it one more time for me so you can know what you did
[42:57:02] all the things you get to get to that 45 okay take another deep breath for me
[42:57:09] I want you to see yourself outside with your friends
[42:57:11] doing the things you wanna do
[42:57:13] cause that's gonna happen right after you beat this game
[42:57:15] Right after you get past that 40%,
[42:57:17] that 30% that 20,
[42:57:19] that 10.
[42:57:20] Right after that is where your friends are
[42:57:22] that grass I want you to see yourself there real quick.
[42:57:27] Enjoy that moment because you're going to make it there,
[42:57:29] but you've got to see it and put yourself there before
[42:57:31] you get there so that you know what's happening.
[42:57:33] You can see it happening
[42:57:34] And you are already in the process of making it happen
[42:57:36] You're counting down time
[42:57:38] You already got to 45%.
[42:57:39] That's over half.
[42:57:41] And then come back.
[42:57:45] Take another deep breath in here, breathing is important.
[42:57:50] Yeah. I want you to cut yourself some slack, because
[42:57:52] you go hard at these games.
[42:57:54] Yeah but it's hard!
[42:57:56] They game going hard on me!
[42:57:58] But you got 45, so he was kicking up until
[42:58:01] 45%. So don't let it
[42:58:03] put you in a defeated energy
[42:58:05] or defeated headspace because then you're going to
[42:58:07] continuously feel defeated.
[42:58:08] I made it to 45, that's a good thing.
[42:58:11] It's a good thing.
[42:58:12] You're going to get outside.
[42:58:13] You're gonna hang out with your friends.
[42:58:14] Those are all good things but you have
[42:58:15] to see and feel yourself
[42:58:17] in that positive space instead of getting frustrated
[42:58:20] and stressed about continuously not making it to
[42:58:24] the place that you want to get. You have to see and feel confident I'm gonna make a 10%
[42:58:28] I'm going to defeat this person, we have hours left."
[42:58:30] And that's just his train you can knock
[42:58:32] this game out whenever that time is for you but i think
[42:58:36] for now
[42:58:38] we get so stuck going oh we're here right now it's gonna happen
[42:58:41] if you put so much energy
[42:58:43] and focus on it not happening
[42:58:45] its going to make it harder
[42:58:46] to feel like it can't happen.
[42:58:48] So know that it's gonna happen.
[42:58:49] Well what about this ass?
[42:58:51] Do you think your ass? I'm pretty ass.
[42:58:54] I might hit a thousand!
[42:58:56] I think that it's
[42:58:58] a challenging game, I am not
[42:59:00] huge gamer, I played couple of games
[42:59:02] so i do know they can be challenging.
[42:59:04] But it doesn't mean your ass and means
[42:59:06] that this is a challenging experience that you're going to have
[42:59:08] to navigate through an obscene, be resilient.
[42:59:10] You've beat games before.
[42:59:11] I've seen your videos.
[42:59:13] I'll be Minecraft. I beat Minecraft. Mm-hmm.
[42:59:15] I beat Red Dead Redemption 2.
[42:59:17] I beat Only Up.
[42:59:18] Say it again.
[42:59:19] Give me those games again.
[42:59:20] I beat Minecraft.
[42:59:21] Period, uh-huh.
[42:59:22] I beat Red Dead Redemption 2.
[42:59:23] Mm-hmm.
[42:59:23] I beat Only Up.
[42:59:24] Okay.
[42:59:25] I beat the first other one to play through. Mm-hmm. I beat Only Up. Okay. I beat the first Alderman to play through.
[42:59:25] Mm-hmm.
[42:59:26] I beat Detroit Becomes Human.
[42:59:27] Mm-hmm.
[42:59:28] I beat, what else did I beat?
[42:59:29] Six games so far.
[42:59:30] What else did I beat?
[42:59:31] So how'd you keep going in those games?
[42:59:32] You were playing a lot of different teams.
[42:59:33] Yeah.
[42:59:34] I was playing a lot of different teams.
[42:59:35] I played a lot of different teams. I played a lot of different teams. I beat? Six games so far.
[42:59:36] What else did I beat?
[42:59:37] So how'd you keep going in those games? How'd you be doing it?
[42:59:39] Spider-Man?
[42:59:40] Spider-Man was a good one yeah.
[42:59:41] On the hardest difficulty.
[42:59:42] Really?
[42:59:43] Yeah.
[42:59:44] Okay.
[42:59:45] So if you can make it through those,
[42:59:46] I have no shadow of a doubt that you can make it to this i have no shadow of a doubt that you
[42:59:46] can make it to this last game right now but
[42:59:48] no but this one is different what makes it different it's a thousand times
[42:59:52] harder what's making it a thousand pounds harder
[42:59:54] madonna his dumb ass His whole family's fucked up.
[42:59:58] He got some weird person on his back that wanted to give me a hug and whisper in my ears
[43:00:02] And instantly killed me. His whole family is fucked.
[43:00:04] Everybody.
[43:00:06] Melania I killed her she was the hardest one by the way.
[43:00:09] She killed me 500 times.
[43:00:10] I killed her last time right?
[43:00:12] But damn like him
[43:00:13] bro he is so annoying.
[43:00:17] It sounds like this character's giving you a hard time
[43:00:20] so what you need to do instead of being angry that he's being annoying and angry
[43:00:23] that he's kicking your butt be excited to win
[43:00:27] be excited that you're going to beat this game
[43:00:28] this is going to be another game on this list of games that you're going to beat this game. And, this is gonna be another game on this list of games
[43:00:30] that you beat.
[43:00:31] That's the energy you need to focus on.
[43:00:33] I'm gonna beat this game.
[43:00:34] I'll beat these games.
[43:00:35] I know I can do it.
[43:00:36] And, that's a way better headspace than getting frustrated
[43:00:38] and angry at this character that's going to continuously
[43:00:41] beat you. If you're giving him that angry energy, it's gonna meet you right back pow!
[43:00:45] I need you to get in that positive confident resilient energy that you have
[43:00:49] because you do have it.
[43:00:50] You beat seven games thus far.
[43:00:53] You're almost done with this one.
[43:00:54] Can I show you a run-up real quick?
[43:00:56] Let's see.
[43:00:56] Do you want to see how scary this is?
[43:00:57] Let's see how scary this is.
[43:00:58] No no!
[43:00:59] It's not scary.
[43:01:00] Do you wanna see how fun this is. Want to see how fun this is?
[43:01:01] Let me see how fun this is, excitingness is.
[43:01:03] Yeah, very exciting.
[43:01:06] Watch this.
[43:01:09] I'm going to show you one run.
[43:01:10] If I die, I die. Okay. But don't say that!
[43:01:13] I mean... When I win?
[43:01:15] I'm a winner, Tyson!
[43:01:17] You're fine, yes! You got this, let's see.
[43:03:23] Whew so so so so so so so so so so so I got greedy.
[43:03:25] I got fucking greedy!
[43:03:41] It's okay, but you weren't going at him for a bit. Do you feel like you gave him a good run. You wanna go again? Nah, I don't want to go again. I just... yeah. Take a break.
[43:03:42] Okay.
[43:03:43] So you gave him a good one and said that you feel like you got greedy.
[43:03:45] That was like 55%.
[43:03:47] Okay!
[43:03:49] But I bid at 55% of my fucking life
[43:03:53] Yeah, no
[43:03:54] I mean it definitely was a tough
[43:03:55] I saw the run
[43:03:55] It was tough
[43:03:56] But you got him
[43:03:56] So you went from 45 to 55
[43:03:59] That's what we just went through?
[43:04:00] Yeah
[43:04:01] I've always hit 55 Okay And that's okay because you wanted to go lower
[43:04:05] got it hurt i'm new to this world forgive me all right so i think it might be a space if
[43:04:10] you're frustrated he's not giving you the freedom to do this.
[43:04:14] You might need to pull away and give yourself a good five minutes of just resetting
[43:04:18] and putting your energy only on seeing that good run,
[43:04:21] only a continuous good run.
[43:04:27] Go ahead. Okay. Mm-hmm. run only a continuous good run okay but what if like
[43:04:27] I take that like the five like the breaks
[43:04:31] I always say like when you keep going like back
[43:04:33] to back like you're warmed up.
[43:04:34] You just kind of get used to it.
[43:04:36] So five minutes might be crazy.
[43:04:38] Might be crazy?
[43:04:39] Yeah.
[43:04:39] Do you think you're gonna die
[43:04:40] if you do something for five...
[43:04:41] Let's say two minutes.
[43:04:43] Can you do two minutes?
[43:04:45] 120 seconds of just calm headspace
[43:04:49] Alright, how many tries though?
[43:04:53] You set the goal. So after how many tries do you feel like you get that level of
[43:04:57] pressure? Is it after every game? Five. Five, so you want to after every five games
[43:05:01] take a 120 second break, close your eyes see yourself getting
[43:05:05] to 45 because we're going all the way low. See yourself
[43:05:07] with your friends. See yourself outside
[43:05:09] That goal post that's after
[43:05:11] the goal post you might have
[43:05:13] to do and I think that could be a good
[43:05:14] The average bad one is probably like 30, 1 second to like no 5 seconds to like
[43:05:24] One minute thirty and the average good one is probably like five to seven minutes
[43:05:32] So a bad one is when you die early within the thing
[43:05:36] There's I guess it's like a minute in 30 and a good average. Good seconds to like a minute and 30.
[43:05:39] And an average good one is like five to seven minutes if you beat them.
[43:05:45] Like for me, I'll probably take like seven minutes.
[43:05:47] That's how long a run is.
[43:05:48] So imagine you take every try as like seven to. That's how long a run is. So I imagine you take
[43:05:49] every try
[43:05:50] as,
[43:05:50] like,
[43:05:50] seven to eight minutes
[43:05:51] long.
[43:05:52] And that's why
[43:05:52] I think you might be
[43:05:53] really benefiting
[43:05:54] or you would benefit
[43:05:55] from a break.
[43:05:56] You really would.
[43:05:57] If you're going
[43:05:57] at hard,
[43:05:58] super expensive,
[43:05:59] ah!
[43:05:59] Hold on, let me just reset when you're
[43:06:01] like me gather my energy because you're putting it all out
[43:06:04] you might want to reserve that so you can tactfully think
[43:06:07] instead of getting it all out let's you want to get it out
[43:06:10] but you also want to realign like yourself
[43:06:12] So you're not just outputting and outputting redirects
[43:06:15] You can put in the right tactic so what okay with my bill
[43:06:18] Right do you think it's that keep hitting 55 55 55? right Do you think, it's like I keep hitting 55-55-55 right?
[43:06:22] Do you think
[43:06:24] I should go like cause they just recommended
[43:06:26] me something new to like try to help
[43:06:28] do we think i should go out there and
[43:06:30] change a little bit of my shit?
[43:06:33] I think you could. I think ending strategy could be
[43:06:35] a benefit, and if you don't like that, you can always
[43:06:37] revert back, but I think change is good
[43:06:38] even for just a bit, and you can always go back
[43:06:41] But if they're offering that, that might be a sign. This
[43:06:43] may be a reason you're getting out to take on something new see how that feels and then
[43:06:48] take it back if it doesn't work.
[43:06:49] But I do think you could benefit from instead of ah this character reset see yourself getting to the mark you want
[43:06:56] to get see yourself in your head getting to 45 40 30 pow you see them all the way down zero
[43:07:01] see that wing feel that win i gotta be the one you gotta be the one you are the way
[43:07:08] you literally you are the wind but it's like he's the last one aubrey literally the last one, Aubrey.
[43:07:14] Literally the last one.
[43:07:16] But I'm confident that you can do it because if you beat
[43:07:18] the previous and this is the last, it's won.
[43:07:22] This just a matter of a different skill level
[43:07:24] or a different tactic.
[43:07:26] Okay, look, the skill level.
[43:07:28] Like what if it's a skill issue?
[43:07:29] It's not your skills though.
[43:07:31] If the game or whatever is recommending something that's just a new skill
[43:07:34] or a new something you can attain to add to the repertoire
[43:07:37] It's not that you're a bad player. It might be
[43:07:41] I'll be honest
[43:07:43] Be completely honest with me, all right
[43:07:48] 92 hours 992 deaths
[43:07:55] my bad player um i would probably have way worse so no you're actually a phenomenal player compared to people who don't even touch these things.
[43:07:58] So let's tell whose comparison?
[43:08:02] So I think you're being hard on yourself and that's the negative self-thoughts that we
[43:08:05] want to get out of because we only want to think positive, feel positive.
[43:08:08] So again, we can get to that space we're trying to get if you're blocking yourself with, oh,
[43:08:12] what if I'm this or I can't get that?
[43:08:13] Or then you're putting things in a way to get you to that goalpost and you have to remove
[43:08:17] that so you can stay clear to the path of winning, which is what
[43:08:19] your trying to do
[43:08:23] So every time I just go in it's just positive
[43:08:25] thoughts? Yes
[43:08:27] See that win, be the win you've already won seven games make this it will be there
[43:08:34] and you speak that you see that and you work towards it
[43:08:37] it might not be in that moment that you wanted it might not but it'll happen when it's supposed to happen when you gather the
[43:08:44] things you need maybe this is a part of it
[43:08:46] maybe that new skill recommendation or that little thing that they just
[43:08:49] recommended could be a part of it but you won't know unless you take
[43:08:52] those new things implement them to maybe get this final win okay let me try one more time yeah yeah
[43:09:09] how am i win today man yes i'm gonna beat him imma walk through this door and i'm gonna walk through this door, and I'm gonna cook him.
[43:09:14] I'm gonna
[43:09:15] walk through this door, and I'm gonna beat him.
[43:09:17] See? I'm fucking up already!
[43:09:18] No, it's okay, Kai.
[43:09:21] Just go back and reset.
[43:09:22] Go back and reset.
[43:09:25] Go back and reset.
[43:09:27] I'm actually having a lot of fun.
[43:09:31] Good! This is fun watching you play. You're great at this.
[43:09:34] It's really fun.
[43:09:38] This is like the last boss fight. After this, I'll be with my friends
[43:09:42] After this I might be so sad that it ended because of how fun it was.
[43:09:46] You know?
[43:09:47] You might miss it!
[43:09:48] I might miss it!
[43:09:49] You're right, I might miss it.
[43:09:50] Let me have some fun.
[43:09:51] Have some fun.
[43:09:52] So I'm gonna win this one here.
[43:09:53] Let's do it.
[43:10:19] Oh my god. Oh my god. Have some fun. So I'm out of windows right here. I love this game. I love this game!
[43:10:27] I HATE THIS GAME!!! I hate this game! FUUUUCK!
[43:10:35] But that's what makes it a game you have to play to win.
[43:10:39] I rode along right there, that was my fault.
[43:10:41] Was your fault?
[43:10:42] I love this game.
[43:10:43] You're gonna win this game.
[43:10:45] I'm going to win this game.
[43:10:46] And you know how to do this.
[43:10:47] You know what you're doing. Yeah, I know yeah
[43:10:51] Before it was so crazy because when I first played this
[43:10:53] I didn't know shit
[43:10:57] And now I know it.
[43:11:05] I love this game! You think you're gonna win?
[43:12:01] Yeah, yeah you're gonna win so so I love this game.
[43:12:35] I love this game! It this game it's so fun man yeah so It's okay. And that's okay.
[43:12:37] And that's fine.
[43:12:39] That one is fine!
[43:12:44] Hey, what was that? I don't know what that was.
[43:12:46] Oh you just almost laughed?
[43:12:50] No, I see that!
[43:12:52] I laughed?
[43:12:54] I don't think I laughed. Am I not small because i'm excited but sure no you just
[43:12:58] laughed at me i did not laugh at you no she just laughed at me did i laugh at him yes
[43:13:04] i wouldn't laugh with you i don't find anything to be funny
[43:13:06] i think that you're doing great at this game, and I think you're working hard.
[43:13:08] Why do you think I'm ass?
[43:13:09] I don't think that...at all!
[43:13:11] I'm actually rooting for you because it's exciting to watch you play.
[43:13:14] Hold on, clip it!
[43:13:18] No, you gotta clip it! You promise you're gonna laugh?
[43:13:20] I did not laugh.
[43:13:26] Clip it, are you going back to this clip?
[43:13:29] Yeah.
[43:13:31] I'm so confident that I did not laugh at this one.
[43:13:37] You're so serious right now.
[43:13:43] Wait, wait chat!
[43:13:51] I did not laugh. Over 100,000 people just see you laugh.
[43:13:53] I don't find this to be funny.
[43:13:55] I wouldn't laugh.
[43:14:05] You guys, I don't them know i didn't laugh might have smiled because i'm gonna support it it's okay.
[43:14:12] That's fine.
[43:14:14] That was just fine.
[43:14:16] That was my nose.
[43:14:17] That was a nose twinkle, lip shuffle.
[43:14:20] That's not a laugh.
[43:14:20] A laugh includes teeth.
[43:14:22] Trust me.
[43:14:23] I laugh a lot.
[43:14:24] Now I just want to.
[43:14:25] No!
[43:14:28] I know what somebody's
[43:14:29] That is not stopping.
[43:14:31] My left nostril is running.
[43:14:32] If you wanna look...
[43:14:33] You hold it in!
[43:14:34] That is not a laugh, that's not a laugh, not a laugh
[43:14:37] It's literally 4K!
[43:14:38] That's not a laugh, that's an adult
[43:14:43] There's no comedy or like what
[43:14:47] literally clueless in which you're speaking up i did like a nervous thing
[43:14:51] ah I did like a news thing. She didn't laugh, she didn't laugh.
[43:14:54] I'm sorry, I'm sorry.
[43:14:56] Okay okay okay yeah.
[43:14:58] She didn't laugh, she didn't laugh.
[43:15:00] W w w
[43:15:02] Yeah yeah. Okay I'm sorry, I'm sorry, I'm sorry.
[43:15:05] All right.
[43:15:05] All good.
[43:15:06] What would you say is like...
[43:15:07] Okay.
[43:15:08] This is a tough one.
[43:15:09] If you had to give me the motivational send-off conclusion wrap up, what would it be i'm gonna say and i and it has to
[43:15:17] be good because i don't like i want to beat it today
[43:15:21] like i wanna do that today but honestly you're dying to get back in your life
[43:15:24] no i know like yesterday okay cool but today
[43:15:27] i want to beat it yeah so i think that we always want things in our time
[43:15:33] someone should be patient in the universe.
[43:15:36] So don't win it?
[43:15:37] You're going to win this game, but don't think you're going to win when you want
[43:15:40] to win...
[43:15:41] I want to win in two minutes.
[43:15:42] It's not gonna happen because you want to win in two minutes.
[43:15:45] Take everything that you need, the new tips, all of this
[43:15:47] the visualizing yourself in a different
[43:15:50] space, the positive
[43:15:51] self-talk, the positive thoughts
[43:15:53] those are things that you're going to have
[43:15:55] to implement to win this game. That's not a time thing
[43:15:58] of like, oh it's going to happen in 30 minutes, 40
[43:16:00] You're going to beat this game. If it's today
[43:16:02] It's today. See it being today
[43:16:04] Feel it
[43:16:05] So if I'm going to leave you with anything
[43:16:07] Positive thoughts just so if i'm going to leave you with anything positive thoughts positive self-talk
[43:16:11] see yourself winning this game and see yourself outside with your friends
[43:16:16] all right can we do the uh the imagination thing again? That helps a lot.
[43:16:18] Yeah, so you're going to close your eyes and take one deep breath for me.
[43:16:26] Good. Give me another one.
[43:16:34] Give me one more.
[43:16:42] Now I want you to see yourself winning that game, you just played this game a ton of times so yourself winning.
[43:16:43] See that bar going down and lower and lower and lower till it gets the final to where
[43:16:48] you feel that when can you you feel, can you see it?
[43:16:52] It's like so close right?
[43:16:53] See yourself winning that game.
[43:16:55] I feel it!
[43:16:56] Can you feel it?
[43:16:57] Feel the joy and excitement
[43:16:58] of people cheering for you,
[43:17:00] the people rooting for you,
[43:17:01] your own excitement about it.
[43:17:03] Then see yourself outside like yo,
[43:17:05] I am out side with my friends and my fam
[43:17:10] doing things that I do
[43:17:13] because that's what is going to happen
[43:17:15] positive self talk
[43:17:17] positive thoughts
[43:17:19] open your eyes for me
[43:17:21] God W Aubrey.
[43:17:25] Nah, check W that help bro!
[43:17:27] That can help.
[43:17:29] Thank you so much Aubrey.
[43:17:31] Appreciate you.
[43:17:34] You're welcome. I'll put it back, I'll put it back.
[43:17:36] Okay, that's fine.
[43:17:38] You got this!
[43:17:40] Oh, my phone. Yeah yeah, I got this.
[43:17:42] Alright, bye. phone yeah i got this here all right bye. Oh.
[43:18:13] Where Duke at?
[43:18:14] I don't know if Duke watching. Tell him to pull back up.
[43:18:19] What did duke want to tell me? Fuck!
[43:18:25] Yeah, re-blow dude! You're a good boy. Wait. Wait! Wait, wait hold on!
[43:18:52] Wait chat!
[43:18:55] How do you pronounce the creators of Elden Ring?
[43:19:01] What's their company name?
[43:19:08] Is it... no, not FromSo from soft the other one
[43:19:15] his bun how do you pronounce it?
[43:19:22] How do you pronounce it?
[43:19:23] How do you pronounce it?
[43:19:24] Bandai?
[43:19:27] Is it Bandai or Bandai?
[43:19:39] Bandai. Bandai is...Bandai?
[43:19:42] Bandai. You're literally watching the stream!
[43:19:47] They are literally watching the stream!
[43:19:51] Lower my difficulty, please! watching this stream.
[43:19:54] Lower my difficulty, please!
[43:19:58] Lower my goddamn difficulty!
[43:20:00] You're watching the stream, bro.
[43:20:02] Please, bro. Please, bro. You're watching the stream bro, please bro!
[43:20:03] Please bro!
[43:20:06] Go into my file.
[43:20:09] Bro look, look...
[43:20:12] Look bro, go into my file.
[43:20:15] Okay?
[43:20:16] They're probably laughing at me!
[43:20:18] They're laughing bro!
[43:20:20] Go into my file and just lower it please whatever
[43:20:27] what
[43:20:27] ...
[43:20:29] ...
[43:20:31] ...
[43:20:33] ... you
[43:21:02] bro chat Okay.
[43:21:04] What's rule number one, chat?
[43:21:06] What's rule number one? What's rule number one? more number one
[43:21:07] what's more than one rule number one you get better
[43:21:15] good shit the new shit, right? Summon Duke?
[43:21:19] DEEBADU!
[43:21:22] YEAH DEEBADUU!. Yeah, I do.. My summer is not working. Okay.
[43:22:21] It's okay, chat.
[43:22:33] Chat, have'm officially... Hold on a sec. Wait hold on!
[43:22:35] I've officially took longer on Redon than I have millennia.
[43:22:39] Yo!
[43:23:02] I'm officially taking longer on Redon I have millennia. Yo! The only reason why I'm not tripping is because... But the only reason why i'm not chipping bro
[43:23:08] is because it's a last boss bro wait hold on as long as my friend what are is Ruby it's still
[43:23:17] struggling yes ruby is still struggling okay so we good
[43:23:23] we're good we're good and we good. We're good. We're good. We're good.
[43:23:26] Who beats haven't beat it?
[43:23:29] We're good.
[43:23:30] Okay.
[43:23:30] Okay.
[43:23:31] Okay.
[43:23:31] Oh, okay.
[43:23:32] Okay.
[43:23:32] Okay.
[43:23:33] Okay.
[43:23:34] But he's's probably as long
[43:23:37] As he don't beat before me
[43:23:38] He is hit
[43:23:39] He is hitting, I'm lowering him a lot more now
[43:23:43] To second phase
[43:24:09] That's it, I'm good! Mother Me What the fuck? I've eaten that damage But only this one
[43:24:11] Oh, it's free!
[43:24:15] No...
[43:24:20] My brother ah my brother
[43:24:47] we hit us together bro so I'm gonna go. Yes, we in this together bro.
[43:24:50] We're in this together bro
[43:24:51] Wait, every death he gets he has to donate?
[43:24:59] 110 subs!
[43:25:10] Oh my god, I would have been bankrupt Oh my god!
[43:25:21] Not gonna lie Do that
[43:25:22] Fuck no
[43:25:24] Hell nah
[43:25:26] Wait
[43:25:29] Every 50 deaths what?
[43:25:30] 50 gifted?
[43:25:58] Y'all to do that at a oh my god. Wait, what? Wait, chat. What's going on with Dr. Disrespect? He just posted.
[43:26:22] Wait, who can I watch to see what he said or some shit?
[43:26:41] Okay. watch and see what he said or some Wait.
[43:26:46] What did he say his final...
[43:26:49] He said like a fi- Wait what?
[43:26:52] Wait, what the f-
[43:26:53] What the fuck happened?
[43:26:54] Child where the fuck have I been?
[43:26:56] Yo what the fuck is going on in the outside world?
[43:27:05] That is precisely why he will be taking an indefinite break from streaming.
[43:27:10] You know?
[43:27:14] Shit like this happens over the weekend and
[43:27:15] it just kind of
[43:27:18] It's like It just kind of...
[43:27:23] It's like how much, How many times can I
[43:27:27] Just. I don't know.
[43:27:33] Like I'm actually tired of being on social media. And I've expressed that over the years, champs. So I just...
[43:27:37] I always kind of hinted like it'd be nice to get off-screen
[43:27:39] and not have to go through all this stuff because you're going to see a lot more you know I've always kind of hinted
[43:27:42] like it'd be nice to get off
[43:27:44] and just completely separate right
[43:27:46] go live in Costa Rica or something
[43:27:48] I don't know.
[43:27:59] But I'm just feeling burnt out,
[43:28:01] I think, You know?
[43:28:03] I came into this
[43:28:07] with...
[43:28:09] When did we start streaming champs?
[43:28:11] 2015? 2016? been doing this since 2009 you know different
[43:28:23] scene back then how How to get time.
[43:28:25] Is he quitting?
[43:28:27] Playing the games that were fun to interact with and
[43:28:29] Oh, you're retiring!
[43:28:31] Create content with and over the years
[43:28:33] Why is it tiring?
[43:28:35] I don't know, like the-
[43:28:38] It's been drained out of me.
[43:28:39] It's being drained out of me.
[43:28:43] It's being drained out of my family and I.
[43:28:46] A MINORRRR! Feel like, uh...
[43:28:47] WHAT?!
[43:28:49] You know.
[43:28:50] You know, I had the mindset of-
[43:28:53] Let's...
[43:28:57] Okay hold on! Wait.
[43:28:59] Before I jump to conclusions
[43:29:03] before I jump to conclusions
[43:29:05] let me go do my research first.
[43:29:07] I wanna see his tweet, hold on.
[43:29:09] I don't know.
[43:29:11] I'm just feeling burnt out.
[43:29:15] Maybe it's time to start something new. Something different.
[43:29:20] Challenge those creative senses...
[43:29:24] A desire to explore different realms, if you will.
[43:29:31] But I think the first and foremost
[43:29:33] though is
[43:29:34] I did have a
[43:29:36] sort of a planned vacation coming up.
[43:29:41] And I think I might just extend that starting today,
[43:29:45] starting now.
[43:29:47] You know one of these
[43:29:49] let's take a step back
[43:29:52] I mean it is what it is people get fatigued
[43:29:56] right champs
[43:29:57] and to be honest I don't know how long. You know, I know from a vacation that how long my vacation is but you know...
[43:30:10] Maybe I extend that is, but you know.
[43:30:11] Maybe I extend that.
[43:30:15] We'll see.
[43:30:17] We'll see.
[43:30:22] But I do appreciate you guys, champs.
[43:30:26] Right?
[43:30:31] And look out for the socials.
[43:30:33] I'll keep you updated when we'll be back, but I definitely need to take a break from
[43:30:37] everything, you know?
[43:30:46] A podcast.
[43:30:46] Start a podcast.
[43:30:50] I think what I'm most interested in... And believe it or not, champs...
[43:30:51] Because obviously when you're top tier gamer like me
[43:30:54] When your gaming skill set is just incredible
[43:31:00] You know, you look like this. Why wouldn't you want to be in front of the camera all the time?
[43:31:07] But I'm kind of
[43:31:09] I'm exhausted and being in front of the camera. I'm exhausted being on socials
[43:31:14] The industry's changed so
[43:31:15] much, just
[43:31:17] so much different energy out there, negative
[43:31:19] energy and clashing
[43:31:21] from everything that
[43:31:23] we've experienced since we started this whole journey together, you know what I mean champs?
[43:31:29] I think he's just repeating himself a whole bunch of times.
[43:31:32] Okay, let me see if this is shit.
[43:31:34] Dr Disrespect let me see this is Goddamn!
[43:32:01] God damn!
[43:32:06] I'm trying to read this perfectly.
[43:32:08] The Twitch Band,
[43:32:09] Hello!
[43:32:10] I'd like to make a quick statement.
[43:32:11] Let's cut the fucking bullshit.
[43:32:12] As you know there is no filter with me.
[43:32:14] I've always been up front and real
[43:32:16] with you guys on anything that
[43:32:18] I can be up front about.
[43:32:19] And, I've always wanted to accept responsibility which is why
[43:32:23] I am here now. First and foremost, I do not want to apologize
[43:32:27] to everyone in my community as well as those close to me.
[43:32:31] My team and everyone at Midnight Society Game Studio.
[43:32:35] A lot of people have been left in the dark
[43:32:37] about what happened yesterday with Midnight Society and I, and we made the
[43:32:41] painful decision collectively
[43:32:42] to have me step down. Our team
[43:32:45] is full of incredibly talented
[43:32:47] and good people that
[43:32:49] have high career ambitions and families,
[43:32:52] and I never want to jeopardize the culture we have carefully crafted.
[43:32:57] Everyone has been wanting to know why I was banned from Twitch
[43:33:00] but for reasons outside of my control.
[43:33:02] I was not allowed to say anything for the last several years.
[43:33:06] Now that two former Twitch employees have publicly disclosed
[43:33:10] their accusations,
[43:33:11] I can now tell you my side of the story we're going in the band wait hold on
[43:33:21] i probably disclosed the accusation okay accusation I think it's close to accusations.
[43:33:23] Okay, accusations okay.
[43:33:27] Were there twitch whisper messages with an individual minor
[43:33:31] back in 2017 the answer is What the fuck?! 24-7. 42 minus 7 is 35!
[43:34:15] This nigga's... WHAT THE FUCK?!
[43:34:19] Regardless bro, no matter what age you are, what the fuck? Like nigga you can't- What the fuck!
[43:34:24] No ma- A MINOR?!
[43:34:33] Hold on.
[43:34:34] What the real intentions behind these messages they answer...
[43:34:39] Is absolutely not. What were the messages?
[43:34:40] What were the messages?
[43:34:42] There was casual mutual conversation that sometimes leaned too much in the direction of being inappropriate but nothing more
[43:34:56] oh minor Oh, minor!
[43:35:03] Nothing illegal happened. No pictures were shared.
[43:35:05] No crimes were committed.
[43:35:08] I never even met the individual." What? I went through a lengthy
[43:35:13] adaptation regarding a civil dispute with Twitch and that case was resolved by settlement.
[43:35:22] Let me be clear, I was not a criminal case against me
[43:35:24] And no criminal charges have been sent brought against me
[43:35:27] Now from a moral standpoint
[43:35:30] I absolutely take responsibility.
[43:35:31] I should have never entertained these conversations to begin with.
[43:35:35] That's on me.
[43:35:36] That's on me as an adult, a husband, a father.
[43:35:39] It should have never happened. I get it
[43:35:42] I'm not perfect and I fucking own my
[43:35:44] shit. This was stupid
[43:35:46] now with all this said
[43:35:48] don't get it fucking mistaken. I've seen
[43:35:50] all the remarks
[43:35:51] and labels being thrown
[43:35:53] around so loosely. Social media
[43:35:55] is a destruction zone. I'm no fucking predator
[43:35:57] or pedophile. Are you kidding me?
[43:35:59] Anyone that truly knows me
[43:36:00] fucking knows where I stand on...
[43:36:03] What? Bro, what?!
[43:36:06] Bro, what?!
[43:36:09] Bro, I'm not even gonna lie.
[43:36:21] Me even hearing somebody like who's like 18 years old is like that shit cringes me bro like anything below like rolling what the
[43:36:32] bro
[43:36:35] where is that? I don't know where's my standpoint.
[43:36:37] That's a different level of things with those types
[43:36:39] of people, fuck that. That's a different level
[43:36:41] of disgust that I fucking hate even hearing about
[43:36:43] Don't believe in me as the worst of the worst with your
[43:36:46] exaggerations. Get the fuck out of here
[43:36:48] with that shit, but I think
[43:36:50] I've said what I needed to say
[43:36:52] regarding the band itself.
[43:36:54] That's it. That's why Chish made a decision in 2020! I'm not gonna lie, Twitch cooked!
[43:36:59] I thought there was a whole like... nigga they cooked!
[43:37:05] I'm not gonna lie, bro.
[43:37:08] They did the right thing!
[43:37:14] I'm not even gonna lie.
[43:37:14] And they banned you and like try to cover your,
[43:37:22] or just try not to make it go public.
[43:37:25] And you had all this time to just be chilling.
[43:37:33] To my team, community and industry friends that have supported me I apologize
[43:37:36] I wish I could've said it all sooner
[43:37:38] You guys have always shown me in my family love apologize i wish i could have said this all sooner you
[43:37:38] guys have always shown me and my family love
[43:37:41] support throughout all these years we love you guys like you can't imagine
[43:37:44] i had the best community in circle if any of
[43:37:48] this has made you uncomfortable, I get it
[43:37:50] You don't have to support me anymore
[43:37:51] but just know you have always been greatly appreciated
[43:37:54] But trust me when I say
[43:37:58] this to all my haters that live and breathe social media with zero
[43:38:02] real life experience.
[43:38:03] I don't give a fuck about you.
[43:38:05] Finally, if your uncomfortable with this entire statement and think im a piece of shit thats
[43:38:09] fine but Im not fucking going anywhere.
[43:38:12] I'm not the same guy that made the mistake
[43:38:14] all those years ago.
[43:38:15] I'm taking extended vacation with my family as mentioned
[43:38:17] on stream and I'm coming back with
[43:38:19] a heavy weight off my shoulders.
[43:38:21] They want me to disappear, you're fucking right.
[43:38:24] Oh my gosh!
[43:38:34] Oh my fucking gosh Niggas are starting to say Dr. Diddy
[43:38:42] Oh my gosh, yo the internet is too fast bro, what Oh my goodness, y'all.
[43:38:54] What the fuck? How old was she?
[43:38:58] That's not the fucking point. She was below the age bro. so. I didn't have the same energy about Drake.
[43:39:32] But are y'all like slow?
[43:39:36] But are y'all slow?
[43:39:37] I don't have the same energy
[43:39:39] about Kendrick
[43:39:41] with the
[43:39:43] fucking beating on his wife
[43:39:45] allegation because there was no fucking proof i don't have
[43:39:48] no energy on the fucking shit that kenji said about drake because there was no
[43:39:51] fucking proof
[43:39:55] that's why bro.
[43:40:01] But this...
[43:40:04] Oh no, that Drake video was kinda crazy my nigga.
[43:40:06] Ah fuck. video was kind of crazy my man oh what the was he thinking Oh my God, my boy.
[43:40:23] Go take that break bro.
[43:40:25] Hey look though.
[43:40:27] Hey hey look. Hey hey hey look hey look bro go take that like just
[43:40:33] like you know go go get out your whole life and shit you know damn like this shit.
[43:40:40] You know?
[43:41:05] Damn!. Why you unfollow them? I just...
[43:41:08] Like, I don't know, chat.
[43:41:10] I gotta unfollow a lot of niggas.
[43:41:14] It's just a...
[43:41:15] Bro.
[43:41:17] Yeah!
[43:41:19] Ah!
[43:41:21] Y'all might have made this a situation bro i just he like you feel me
[43:41:31] it's i'm following crazy is that crazy
[43:41:35] Is that it's actually crazy. Oh my god, they might have dragged this shit
[43:41:38] I know they are I know they're gonna drag it bro. They literally want to drag this whole shit
[43:41:43] Oh my god, I can never get my name out of this nothing bro.
[43:41:47] Ahhhhhh
[43:41:48] Imma fuck-
[43:41:49] I'm under a magnified glass
[43:41:52] I mean I don't care
[43:41:54] Damn that's crazy as f-
[43:41:57] Whoa!
[43:43:14] Damn Damn! That's actually insane.... Holy! lee oh my gosh unfollowed Drake but what shit have you guys seen
[43:43:17] well
[43:43:18] that shit is okay well that is Yo, why is that video so bad?
[43:43:35] Why is that video
[43:43:36] So fucking bad Fuck you for that! FUCK YOU RADON!
[43:44:18] This chick not fucking with me, bruh. Wait, wait. Oh my gosh!
[43:44:19] Wait, chat.
[43:44:22] Wait, chat. Wait, chat, somebody literally just
[43:44:27] Chat
[43:44:29] Somebody literally just said
[43:44:45] Hold on wait what the fuck is this nigga at? Caleb.
[43:44:54] Look!
[43:45:03] He said If you're having trouble with
[43:45:05] Vandana in dlc just do this I can't take this bro. so Oh my god. Oh!
[43:46:10] Find me that, find me exactly where you're at!
[43:46:15] Ruby is gonna do it. You're lying. You're lying.
[43:46:16] You're lying.
[43:46:17] You're lying.
[43:46:18] You're lying.
[43:46:19] You're lying.
[43:46:20] You're lying. You're lying. You're lying, you're lying, you're lying, you're lying, you're lying!
[43:46:22] You're lying! You're lying!
[43:46:23] YOU'RE LYING!
[43:46:24] OH MY GOD, YOU'RE LYING!
[43:46:27] OH MY GOOOOD!!!
[43:46:29] WTF!!!!
[43:46:31] NOOOOOO
[43:46:33] NOOOOOOOO
[43:46:35] NOOOOOOOO
[43:46:39] NOOOOOOOO
[43:46:43] NOOOOOOOOO!!!
[43:46:49] NOOO!!!! Are you serious?
[43:47:00] NOOOOO!!!!! No! The body is full.
[43:47:28] You need to lose those. foreign Oh Easy Oh, what? Bro lower my difficulty!
[43:47:47] Woo you need to get a skimmy fragments
[43:47:50] If you want to beat this motherfucker Skibby the fragments
[43:47:51] What's that?
[43:47:52] Yo, listen to me
[43:47:54] If you want I can gift you one of my weapons.
[43:47:58] Okay?
[43:47:58] One of my dentist's weapons for you.
[43:48:00] I gifted it to you.
[43:48:01] You deserve it man and you try with that build okay?
[43:48:04] Where is the skinny?
[43:48:14] Joder hermano! Santa... I'm telling you, okay? Lizzy doesn't have five kids.
[43:48:15] I had the fries, man!
[43:48:17] We got friess, right?
[43:48:21] We have that!
[43:48:25] We have all of that.
[43:48:28] We're not maxed.
[43:48:36] Find a find a tool, bro!
[43:48:38] How much wood do I need?
[43:48:41] I'm on 18.
[43:48:44] Does that final sidebar have it?
[43:48:47] He doesn't, right?
[43:48:55] Bro. right well I don't think I'm fine bro I think I need it bro I think I mean I
[43:49:00] think I just didn't max out everything my friends are going outside!
[43:49:25] I think i need it! Bro, how much depth?
[43:49:27] New game plus two by the way.
[43:49:53] Oh my god so I'm 100 subs from the other day, I'll give it to you right now.
[43:49:56] It doesn't matter, the challenge is over.
[43:49:58] There they go again. Is she really? I
[43:50:08] She beat it
[43:50:40] Chat movies actually amazing bro. i'm gonna go to spain is It doesn't matter if you're playing on the wifi of NASA or on your computer.
[43:50:44] Fragments of the Earthquake
[43:50:47] Here are the 100 subs.
[43:50:57] Okay, 100%. 100% we're hitting for too low.
[43:51:02] Sonny, 100% we're hitting for too low in the second phase.
[43:51:06] Like 100%. we've been doing
[43:51:10] this come on let's start to think
[43:51:17] let's start to think bro. We're hitting the nigga for too low
[43:51:30] No, Sonny.
[43:51:31] Oh my fucking god.
[43:51:32] This nigga's an idiot.
[43:51:33] You're an idiot.
[43:51:34] Bro, this nigga is actually dumb.
[43:51:36] Bro!
[43:51:37] I've gotten to...
[43:51:39] Do you realize
[43:51:40] I've been at 55 percent for the past 60 hours with the time of going to 45
[43:51:50] one time do you know what I thought?
[43:51:53] Millenia,
[43:51:54] I was awfully getting down to like 20% after a certain amount of
[43:51:58] time. If there's no progress after that 55,
[43:52:02] after a few hours, something
[43:52:04] needs to change. And that's just
[43:52:05] facts!
[43:52:10] I'm hitting the nigga
[43:52:11] second phase for
[43:52:14] I see me
[43:52:18] hit a nigga from 4-4-8 no,no i don't need that no
[43:52:25] no I don't need that but a staggering much the be hitting him
[43:52:28] for more right now I'll meet this bag was built I can just build.
[43:52:42] Bro, give me... I need the fragments.
[43:52:43] That's what I need.
[43:52:44] Bro, I ain't gonna lie. I need the fragments. Give me what I need. Bro, I ain't gonna lie.
[43:52:46] I need the fragments.
[43:52:46] Give me the fragments bro.
[43:52:48] Give me the fragments.
[43:52:53] Yes I do.
[43:52:54] I need a
[43:52:54] chat.
[43:52:55] You better understand me bro. You may say that I don't but I DO!
[43:52:56] I do!
[43:52:57] I do!
[43:52:58] For who I am, I know myself.
[43:52:59] I do!
[43:53:00] I do!
[43:53:01] I fucking got a problem with this shit.
[43:53:02] I'm gonna go to the bathroom and get some water.
[43:53:03] I'm gonna go to the bathroom and get some water.
[43:53:04] I'm going to take my I do!
[43:53:11] My fucking god, I want you to be panic rolling, bro. Shut the fuck up, cuzzy.
[43:53:23] Yo, ban all the fuckin' mods, my nigga! It's not about getting it and dying again, are y'all fucking... Are you guys...
[43:53:26] Bro, are you slow?
[43:53:27] It's not about getting it and dying again.
[43:53:29] It's about making progress!
[43:53:33] I don't give a fuck about dying!
[43:53:35] I wanna make progress, my nigga!
[43:53:47] That's all I want to do. I just want to make progress, bro.
[43:53:52] If I'm a basketball player and my jump's on his ass
[43:53:57] And I keep practicing to get better
[43:54:00] I'd rather see slow progress than no progress on getting better!
[43:54:04] Niggas want motion the first day they start YouTube!
[43:54:08] No!
[43:54:10] Slow motion is better than no motion.
[43:54:14] You're already making progress?
[43:54:15] No, I'm not.
[43:54:17] I made progress on phase one.
[43:54:19] Yes, but I'm going to 50...
[43:54:22] Have you not been watching have you not been fucking watching
[43:54:27] have you not been watching i'm doing 55 every fucking time.
[43:54:34] I'm literally speaking facts, that's just facts!
[43:54:38] You wanna rewatch the last 60 hours?
[43:54:40] Because we can do that, we can do that. We can do that. Bro, I'm just frustrated bro.
[43:54:55] Like look at this shit!
[43:54:57] Look at this shit oh my fucking god.
[43:54:59] I haven't seen sunlight in how many fucking days?
[43:55:01] Look at this kid.
[43:55:14] Oh my gosh!
[43:55:17] It's fucking beautiful out there, man! Fuck.. Looks good out there man Come on, let's just start doing the hard work.
[43:56:09] Yo! How many frags do I have left Sonny?
[43:56:11] I'm at 18 which means I have...
[43:56:13] No, Imma say it right now
[43:56:15] Imma say it right now
[43:56:17] I have 18
[43:56:21] Which means that- all I need is six more
[43:56:23] I need six more
[43:56:25] I'm at 18 and I need 6 more
[43:56:27] Let me check my inventory real quick.
[43:57:45] I have zero frags!. so... so what's the rest of the frags bro? Where's the rest of the frags bro?
[43:57:49] Haha can't get to a thousand chat. Yo chat, Ruby is this
[43:57:53] Was we just watching will be a struggle
[43:58:04] so what do y'all think bro?
[43:58:06] Do I need to go with a stagger build or should i be going
[43:58:10] with a fucking...
[43:58:14] ... What do you think?
[43:58:20] I feel like a bleed build is crazy bro.
[43:58:25] I'm like, a bleed build is crazy bro i think a blue boat is fire what do you think sonny so so so Thanks for watching! so I'm not sure if this is the best way to do it, but I think you can just go with what's in your inventory.
[43:59:37] I don't know why they're doing that here. so so so so I'm not sure if this is the right way to go, but it's a good idea.
[44:00:31] I think we're almost there. Oh, you got it. Ah!
[44:00:54] Problem Duke. Oh problem probably.
[44:00:58] Check out who you got.
[44:01:01] You got Prom Duke or you got Prima Don?
[44:01:05] That's crazy bro.
[44:01:07] Yo, Duke I'm telling you right now bro Don't hop back on this shit
[44:01:09] Bro, I think I gotta restart
[44:01:12] Wait no you don't
[44:01:13] You just got to do your character
[44:01:14] No, no I'm saying like
[44:01:16] I went back to try and find some
[44:01:18] talismans and shit for my build
[44:01:20] And I had to restart it
[44:01:22] because they was in the beginning of
[44:01:24] the game. I think I
[44:01:26] restarted so hopefully they don't let me restart the DLC
[44:01:29] So what did that with them? Wait, you know what you were your character
[44:01:34] Like I beat my went back. I
[44:01:37] Finished the game like like became elderly and restarted to the point where like...
[44:01:42] Were you playing on New Game Plus?
[44:01:43] Yeah.
[44:01:44] Nah!
[44:01:45] Like this is what I'm still doing now.
[44:01:48] Like I'm finna beat like...
[44:01:50] No! It's gonna be harder though!
[44:01:52] I know that.
[44:01:54] You might as well-
[44:01:56] Wait!
[44:01:57] Every time you restart it gets harder and harder
[44:01:59] That's why you been dying so much times.
[44:02:01] Wait, what the fuck? I'm on like plus five!
[44:02:04] That's why you're dying so much times! The bosses are five times harder!
[44:02:09] No bullshit, I'm on plus five right now. And GFD too.
[44:02:11] Oh, God!
[44:02:15] The nigga been playing
[44:02:15] on a plus-five the whole...
[44:02:19] Well, I'm about
[44:02:19] knocking all this shit over.
[44:02:23] I'm about knocking all this shit over. Bro, all my life when you started over the boxes get harder so your playing on a boss with 5 times the difficulty of that normal
[44:02:31] So if you been playing on that the whole time,
[44:02:33] we should be breezing past this.
[44:02:35] Well who you got to?
[44:02:36] Who you gotta to?
[44:02:38] That's why he took so long on the dancing lion!
[44:02:40] I'm like,
[44:02:41] Why have you taken so long on a lion?! Bro, I bet- Bro, I'm like why is he taking so long on the line?
[44:02:46] Every time you tell me you can restart it. I'm like though are you like oh my god
[44:02:52] That shit was hard as fuck.
[44:02:54] Well you know like pro players do plus 5?
[44:02:56] Like niggas
[44:02:58] Right y'all? Like niggas
[44:03:00] do plus 7!
[44:03:02] Niggas who been going crazy on this game, they do plus five, plus seven.
[44:03:06] You know what I was telling you?
[44:03:07] Like I'm going through the game over and over again.
[44:03:10] You were doing that the whole time?
[44:03:11] I was room farming but I was thinking like all right let me just
[44:03:16] like it was boring to be killing the same enemy so i was going through the game like no way
[44:03:24] i'm like how the the fuck is you?
[44:03:25] I kept saying that.
[44:03:26] How the fuck do you keep beating people so over and over again?
[44:03:29] Wait.
[44:03:30] But you've been on new games.
[44:03:30] Wait, wait, wait, wait, wait.
[44:03:32] So this shit don't translate though, right?
[44:03:34] Maybe I'll just ask.
[44:03:35] No, so Chad, he would have to make a whole new character, right?
[44:03:38] In order to go through with the first time?
[44:03:40] But on plus one?
[44:03:41] Yeah! You need to make a whole new character bro.
[44:03:44] Yeah!
[44:03:47] I'm gonna have the same character this whole time!
[44:03:49] Look, okay look it's easy though
[44:03:51] but I say make a new
[44:03:53] character, find your flask, find your donaties
[44:03:55] get that best weapons I say over level just go on just overlevel just
[44:03:59] over level i've been i don't put in years with this character though man
[44:04:06] yeah it's just the same character from the first AMP? Yes! It's the same fucking character
[44:04:08] From the first AMP
[44:04:09] Nigga I done really put in hours
[44:04:10] With this nigga
[44:04:11] Well how somebody grinded
[44:04:12] That's cheating
[44:04:13] That's not real gamer shit
[44:04:14] Yes it is
[44:04:15] You don't beat it
[44:04:16] On four fucking times
[44:04:17] But gang Are you gonna find somebody right now that can beat it in the
[44:04:21] next how long chat bro no cap cop no count oh god oh yeah no Oh my god I didn't know you was doing that the whole time.
[44:04:31] Why didn't you say nothing?
[44:04:32] No!
[44:04:33] Nigga I thought it was going to reset so like I thought as long as we could see on some
[44:04:38] freshness.
[44:04:41] It's dumb bro he thought you it was just walking and let you overpower the whole time?
[44:04:47] But that's what I'm wondering, why the fuck are you on 300- how many times have you died in a dancing lion?
[44:04:50] Like 100 times. Bro I didn't new game.
[44:04:51] I'm still on the same...
[44:04:53] I knew game five times!
[44:04:55] Oh my gosh, Chad.
[44:04:57] That's crazy.
[44:04:59] So, so...
[44:05:01] Bro.
[44:05:02] Yes, you could have been here, bro.
[44:05:03] You probably could have been the DLC.
[44:05:05] Like legit.
[44:05:05] Like you probably could have finished.
[44:05:07] Yeah, I don't know.
[44:05:08] You probably could have beat it before me.
[44:05:10] It would have been done.
[44:05:10] Like literally done. No bullshit. I'm looking at this game
[44:05:19] No, cuz cuz cuz I gotta see a clip of you
[44:05:22] This might be able to tell.
[44:05:23] Cuz if it's attacks- If he's giving you no healing room that means it's hard.
[44:05:27] No cap! Oh man oh god nigga no bullshit.
[44:05:31] It was one point where Nigga
[44:05:33] I'm literally
[44:05:35] Flawlessly
[44:05:36] Diving this nigga shit
[44:05:38] I'm weaving this nigga shit
[44:05:39] Like
[44:05:39] He not touching me and shit
[44:05:42] And
[44:05:42] I know his moves like this.
[44:05:45] I still do them. Like the nigga
[44:05:49] go up, no no no he'll go up
[44:05:53] This is first phase right?
[44:05:54] First phase shit this how much I knew his shit.
[44:05:57] First phase you go up
[44:05:59] attack one
[44:06:00] attack two
[44:06:01] attack three
[44:06:02] flip
[44:06:03] and then spin smoke
[44:06:04] smoke twice and then spin smoke twice
[44:06:06] and then I can attack him.
[44:06:07] Boom!
[44:06:09] But when he lightning bolt
[44:06:12] it's like
[44:06:13] the shit so hard because he'll do it again three no you can't we lighten boat
[44:06:18] there's two times I know I don't like to go two times you roll you roll I noted
[44:06:24] and then like once you roll He might do it once.
[44:06:27] You know what I'm saying?
[44:06:28] And then the lightning come up from under you and shit
[44:06:30] and then he change.
[44:06:31] Yeah.
[44:06:32] I know all of that, but I'm thinking like...
[44:06:34] No, because if it's back-to-back...
[44:06:36] I'm saying no because if he's doing a lightning bolt, lightning bolt,
[44:06:40] Leonard comes and he's going to another one?
[44:06:42] No, you're supposed to have a breathing room between that!
[44:06:44] I didn't have none.
[44:06:45] Yeah, GG's.
[44:06:46] Let Duke try!
[44:06:50] You gonna try?
[44:06:51] I ain't like he's hard as fuck.
[44:06:53] All right so my build you gotta jump L1.
[44:06:54] Jump L was the best is the best.
[44:06:56] Jump L1.
[44:06:57] Yeah, jump L1 is the best thing.
[44:06:59] Let me try it.
[44:07:01] Hey, make sure you do all your power-ups first.
[44:07:03] I know that.
[44:07:03] All of them.
[44:07:04] What type of build do you have? Strength?
[44:07:06] Nah, my shit ass.
[44:07:07] Look at that.
[44:07:08] I done tried strength. I done tried maize. not much
[44:07:22] pre-first try
[44:07:28] but i've been up in the first bowl i'm thinking like what the why haven't you seen i'm upstairs right now dying in the dragon castle right now. Like I'm running through dying
[44:07:33] No, no. Oh hell not NPCs to autumn niggas on that smoke everything five times harder
[44:07:42] MPC's smoke everything five times harder right chat on all the npcs
[44:07:48] all right let me go ahead so i'm out one is the best it's the best oh his moves are difficult though so you want listen first? Yeah, first one.
[44:07:53] Oh my god! You would have been cut Aguilar
[44:07:55] He wouldn't ever beat this nigga
[44:07:57] Plus five? Hell no
[44:08:01] I ain't going with that I have GORSHET.
[44:08:07] Okay.
[44:08:14] Okay, go. Go! I'm gonna go slow.
[44:08:25] What the fuck is good? Bro, you're not doing bad.
[44:08:27] Bro...
[44:08:29] What the fuck was that?! Why he just pulled me?!
[44:08:31] That's an almighty pull or shit! You know who paid me this?
[44:08:34] Nah. Okay. that's an almighty poor you know hey
[44:08:40] hey you didn't do bad though
[44:08:44] now for the first time I'm trying to go, hold on bro.
[44:08:47] No bullshit!
[44:08:48] I've been upstairs going through the story mode on the first one not DLC-ing it.
[44:08:51] I am still trying to get through that
[44:08:56] and the whole time I've been on plus five.
[44:09:00] What? Nah, yeah.
[44:09:01] Yo, Wapus, make a new character, bro.
[44:09:02] Let me show you how I get down, dude.
[44:09:06] Nah!
[44:09:06] This nigga been on plus five.
[44:09:08] That's why.
[44:09:09] There is no way that this whole time?
[44:09:13] Bruh.
[44:09:14] Now your a wilder man.
[44:09:15] You just wasted all your time bro.
[44:09:16] I just wasted like 4 days.
[44:09:17] 4 days?
[44:09:19] That guy's only on ice.
[44:09:23] Ah fuck!
[44:09:27] Alright, alright uh... No no that was my fault Hi. Hi. Uh...
[44:09:28] No, no, that was all right.
[44:09:30] Yeah?
[44:09:31] What did I say about you?
[44:09:33] Yeah, look.
[44:09:35] Unlucky.
[44:09:37] Unlucky.
[44:09:38] Unlucky. Unlucky, unlucky. Unlucky, unlucky, champ! Unlucky, unlucky, unlucky.
[44:09:40] Unlucky, unlucky. Streamer House?
[44:09:41] Oh that's definitely a new nigga.
[44:09:43] Yeah bro it is an A&P crib.
[44:09:46] Unlucky, unlucky, unlucky.
[44:09:48] Bro... Nah, New Game Plus? lucky i'm lucky you're lucky bro nah new game plus not
[44:09:55] chat new game plus bob is actually insane insane
[44:10:03] y'all are so Oh shit. so so so so I'm going to have to do a little more of this. uh I didn't mean to use my flyers, pop chat. so so so so That was a match.
[44:12:44] And that went bad, but you ran out of flash.
[44:12:50] Yeah I ran out of flash though.
[44:12:50] Zero flash by 50%
[44:12:52] Ah fuck
[44:12:53] Damn bro
[44:12:54] Aguilar
[44:12:55] Make that new- make that fucking new nigga bruh
[44:12:58] Make that new nigga bruh
[44:13:00] If i was you, chat!
[44:13:02] Chat if I was him...
[44:13:04] I'm literally going...
[44:13:06] I'm having somebody grind that account
[44:13:08] and then after give me the controller
[44:13:10] Like bro just...bro you beat the game five fucking times
[44:13:15] Everybody DM Duke if you wanna play
[44:13:17] on his account and...
[44:13:34] Who are you at right now? I Who that Jack?
[44:13:36] Godfrey?
[44:13:38] What?!
[44:13:40] I have a lie you beat all them bosses
[44:13:42] Five times So you beat all them main bosses
[44:13:44] five times harder than they originally was.
[44:13:48] It's just tough.
[44:13:48] Not gonna lie.
[44:13:52] You got to have wasted my life.
[44:14:00] Jesus. you gotta waste in my life Jack you know wait the amount of time he's been being his game on five plus nigga I've been I've been playing for one boss on a new game.
[44:14:06] Bruh, no cap.
[44:14:07] They should have me rethinking my...
[44:14:08] They should have me considering if my IQ was low.
[44:14:12] Yeah, this game makes you start feeling like
[44:14:15] are you slow?
[44:14:16] Like am I... is it a skill issue?
[44:14:19] When I was the dancing lion and shit.
[44:14:21] Boom! I got past that.
[44:14:22] I beat it off stream finally right?
[44:14:24] Cool.
[44:14:25] I got to the bitch with the with the two swords oh yeah ggs
[44:14:30] okay she's hard she had me thinking that was slow for real now wait until you get into
[44:14:35] wait till you start fighting mesmer you're gonna be there for a minute no no no no no i was fighting
[44:14:39] snake yes what look i was fighting this boom when he first started
[44:14:45] when i first walked through the midst right right? The nigga come jump up and he
[44:14:49] Look! He hit the ground
[44:14:51] And then he do it again. Boom!
[44:14:53] So look you roll
[44:14:55] And then you roll again. Free-hit
[44:14:57] Yeah yeah yeah He's free-hits right there free hit.
[44:15:01] He's free right there, you know what I'm saying? And then like he do
[44:15:03] some shit where he like do some shit like this
[44:15:05] and then he
[44:15:07] spin and he jump up, and throw that motherfucker like this.
[44:15:10] If you roll in him
[44:15:12] he's free!
[44:15:14] This one-0 is OD
[44:15:16] He jumps up
[44:15:18] And then he goes and he goes yeah and then you do it that one get crazy yeah but that made me
[44:15:26] realize i wasn't ready but now i'm realizing this is is plus five. Yeah, bro.
[44:15:30] I ain't gonna lie.
[44:15:31] You play down plus five?
[44:15:33] Yeah, I ain't gonna lie.
[44:15:34] Make a whole new one.
[44:15:36] Make a whole new one, Chad, right?
[44:15:37] He need...
[44:15:38] That needs to happen.
[44:15:39] What build would you make though?
[44:15:40] What's your go-to bill, though?
[44:15:42] Like what do you feel comfortable with?
[44:15:44] Bro I was using death poker and badet shit ass
[44:15:46] Is that a bleed bill?
[44:15:48] No nigga that's a fucking
[44:15:49] I gotta be this hard
[44:15:50] These niggas be bleeding like fat.
[44:15:53] 6,000 damage.
[44:15:55] Yeah yeah yeah.
[44:15:57] 6,000 bro!
[44:15:59] And I'm still losing Maverick to the 25th hit.
[44:16:01] I have to go find shit right now
[44:16:02] because
[44:16:02] well,
[44:16:03] I keep getting into phase two
[44:16:04] and I keep dying at 55%.
[44:16:07] Like,
[44:16:07] where I was at just now?
[44:16:08] I just keep dying there
[44:16:10] so it serves wrong, bro.
[44:16:11] Bro,
[44:16:11] I think I'm gonna go strength, bro. Yeah. I think i'm gonna go strength bro yeah
[44:16:21] nigga i seen a walk through with a motherfucking shield.
[44:16:24] And he basically just parrying the fuck out of a nigga.
[44:16:27] Oh yeah!
[44:16:28] That's hard though!
[44:16:30] Chat right?
[44:16:31] Shield parries are hard!
[44:16:33] You gotta time it bitch.
[44:16:34] You time it, you better boom they'll break down
[44:16:36] did you put that more fucking in him and you who was he burying anybody damn
[44:16:42] he paid i think he was paying prime regardless Yeah but you know Let Me Solo Her?
[44:16:46] Nah.
[44:16:47] Lemme show you something bro. These niggas right here make me feel like ass.
[44:16:50] But nigga this one- I'm like bro I know I'm a fucking top Eldarine player nigga why is this shit so hard hard but we gotta start going to like
[44:16:57] elderly events and you know no cat like for dreamcon bro i'm gonna be out of ring
[44:17:03] nigga you know bruh you've seen me fall in love with Elring. Nah, I ain't gonna lie.
[44:17:06] Duke put me on the outer ring, bro.
[44:17:08] Hey.
[44:17:09] I ain't gonna lie.
[44:17:10] You seen me fall in love with Elring.
[44:17:11] Dude, Duke put me on the outer ring, bro.
[44:17:13] He was the...
[44:17:13] Bro, I ain't gonna lie.
[44:17:14] He was the first nigga
[44:17:16] in the AAP crib who was on Eldering before everybody.
[44:17:20] You copped it when it dropped, right?
[44:17:22] Yeah yeah yeah
[44:17:24] Chat no cap niggas
[44:17:26] I used to be playing Eldering and shit
[44:17:28] It got so bad to the point where
[44:17:29] I was having bitches come over,
[44:17:31] I wasn't even entertaining them.
[44:17:33] Bitch you finna watch me play
[44:17:35] Elden Ring for fifteen hours!
[44:17:38] No Rage did not put me on the outer ring.
[44:17:39] He was
[44:17:41] on outer ring 24
[44:17:43] 7 before A&P shoots
[44:17:45] after A&P shoots playing that
[44:17:47] shit he would tell a niggas to play it!
[44:17:49] I hopped on, I wasn't enough- nigga
[44:17:51] I actually made it through the tree set and got off
[44:17:54] Okay what the fuck is this?
[44:17:55] I said what the fuck is this game? This game is so dumb
[44:17:57] Cause you gotta dive in
[44:17:59] Yeah once you dive in cause once you beat one person You got a
[44:18:01] Yeah, what you dive in because say you let me solar bro this nigga is crazy
[44:18:14] So that's all mess more social
[44:18:17] This thing it is crazy
[44:18:27] Oh is crazy, bro. This nigga's
[44:18:28] crazy, chat.
[44:18:31] All ball is better? But all the out of the ring niggas are staggling.
[44:18:35] They all got motion bro.
[44:18:37] They're all tough bro.
[44:18:39] He's got good swag too and his drip is fine.
[44:18:42] He got a little motherfucker out there, that's it.
[44:18:45] Let me show you this nigga bro
[44:18:56] On ball, high back. He's so bored that he help niggas fight bosses.
[44:19:00] Look, they're licking up with a nigga, bloody supporters.
[44:19:02] The group password is right there
[44:19:05] they get locked in their support is just stand to the side and he'll be you're a good
[44:19:09] guy he's a great god he's a great girl let's just dumb you fucking man's like this
[44:19:17] the only thing for this one though so that oh because it's gonna be the hard
[44:19:20] one it's like the halfway point Oh, that's rare.
[44:19:27] He never gets hit.
[44:19:32] Oh my god he got hit twice?
[44:19:39] So he like a spirit
[44:19:43] A what?
[44:19:45] He got hit three times!
[44:19:47] Well I've never seen him get hit this much.
[44:19:52] Oh, yeah.
[44:19:53] Whoa!
[44:19:53] Oh my God, that's what I'm waiting on.
[44:19:55] Nah, that's a bad run from him bro no
[44:19:58] no no they died he died
[44:20:01] yeah i think i know let me see what the fuck
[44:20:07] he got his ass out.
[44:20:10] Nah, he...
[44:20:11] Ongbao?
[44:20:12] Okay, I've never seen Ongbao.
[44:20:14] Hold on, let me see.
[44:20:15] Damn, let me solo her.
[44:20:15] It's dumbfire though.
[44:20:17] Ongbao.
[44:20:30] Mezmer. Mezmer. dumb fire though this there's no damage
[44:20:34] God! Just calm. What you talking about man?
[44:20:38] Just Oh, fuck.
[44:20:44] Look at his health!
[44:20:45] Oh my god!
[44:20:49] Three!
[44:20:53] Four! Three! That light roll, bro. That should be five.
[44:20:56] No armor?
[44:20:58] Three!
[44:21:00] Oh my god... Oh my god oh I don't know what he knows Oh my God. He's the room game.
[44:21:56] Oh my god!
[44:22:01] He's boxing! There you go! Oh, there he go.
[44:22:06] Oh you got to move just a little bit.
[44:22:14] God, no heat?
[44:22:18] It's crazy.
[44:22:22] You know what is so crazy? This shit is satisfying as fuck!
[44:22:41] Like you don't get hit bro Oh fuck. Oh my god, wait what?
[44:22:46] Is this what you wanted to miss for squarepence? oh my god what is this What?! so so oh my god so I'm going to get you. You're not getting away with this. You're not getting away with it.
[44:23:52] You're not getting away with it.
[44:23:53] You're not getting away with it.
[44:23:54] You're not getting away with it.
[44:23:55] You're not getting away with it.
[44:23:56] You're not getting away with it.
[44:23:57] You're not getting away with it.
[44:23:58] You're not getting away with it.
[44:23:59] You're not getting away with it.
[44:24:00] You're not getting away with it.
[44:24:01] You're not getting away with it.
[44:24:02] You're not getting away with it. You're not getting away with it. You're not getting away with it. bro bro don't
[44:24:03] tell my like
[44:24:05] that's the problem with me
[44:24:07] I really feel like I can do this
[44:24:09] you know what I'm saying like I feel
[44:24:11] like that's my
[44:24:13] flaw cause I feel like that's my flaw
[44:24:14] because I feel like
[44:24:15] I can really no-hit this bitch ass nigga.
[44:24:17] But is this my fault as well, Jack?
[44:24:23] This can't be my fault as well, no way.
[44:24:25] Nah, hold on I'm just talking about like...
[44:24:33] Three! 3!
[44:24:35] Oh damn, get out of there please.
[44:24:43] You were free right now, man. Look at this.
[44:24:46] You were free right then, look here!
[44:24:50] But when I take my harvest from the animal
[44:24:54] it's gonna kill was funny oh my god
[44:25:05] yeah You see it? Yeah.
[44:25:12] Free.
[44:25:18] Hey, that's how you know I've been playing for real
[44:25:20] cause I know when the niggas free.
[44:25:22] Yeah so you got it bro. New game bro.
[44:25:24] New game.
[44:25:26] Nah bro why wasn't you saying nothing though?
[44:25:29] I didn't know.
[44:25:31] Did you tell these niggas?
[44:25:33] No, I didn't know. I can't tell them something I don't know.
[44:25:37] You didn't tell them like yo,'all beat the game five times?
[44:25:40] No.
[44:25:40] I'm thinking boom.
[44:25:41] New DLC.
[44:25:42] I'm walking in fresh just like everybody else because you remember
[44:25:46] I stayed at level 150.
[44:25:49] Yeah.
[44:25:49] It ain't like, because I had four or five million rooms though.
[44:25:52] You know what I'm saying?
[44:25:53] Yeah!
[44:25:54] So I'm thinking boom, and I beat the game four or five times cool.
[44:25:57] As soon as I start to DLC, I did on stream. You didn't lose your rules that
[44:26:01] once? Uh... yeah, I did!
[44:26:03] That's why I had to-
[44:26:07] I had like four mil in the pocket
[44:26:09] Boom! Died. Lost em'. Restarted again I had like four mil in the pocket. Boom, died, lost them.
[44:26:11] Restarted again and got em all you know what I'm saying?
[44:26:14] Now I walked into BLC with 4-5 million rooms in my pocket
[44:26:17] Yeah
[44:26:18] Spent the rooms
[44:26:19] And got them up there
[44:26:22] is holding it with little system anyway
[44:26:24] all of
[44:26:27] i love bro
[44:26:28] now you know what to do right
[44:26:31] if two people street What you do, bro? What time is it? It's 2.51.
[44:26:33] It's 3.31. No, it's 3.51.
[44:26:34] Yeah, yeah, I have it over there.
[44:26:35] Yep.
[44:26:36] Well, rest of the day.
[44:26:38] I ain't gonna lie.
[44:26:39] Rest of the day, beat the game.
[44:26:40] Tomorrow, DLC, bro.
[44:26:44] You gotta do that shit again.
[44:26:46] Yo, chat, he actually knows what to do
[44:26:47] now, bro.
[44:26:49] Oh my gosh.
[44:26:54] Chat, he actually knows what to do bro.
[44:26:59] Well I'm glad
[44:27:00] he got to find that out. You see sometimes we do need
[44:27:02] a loser shit chat. Chat sometimes... out you see sometimes we do need a we didn't we did it losing chat chat sometimes
[44:27:06] we do need to lose chat you feel me He actually
[44:27:24] He was playing on New Game Plus 5 this whole time
[44:27:27] This whole time
[44:27:31] Alright
[44:27:35] Sonny.
[44:27:37] Chat what do you think?
[44:27:40] I'm so used to jump L1.
[44:27:42] Strength build or bleed build... Stagger
[44:28:26] What y'all think?
[44:28:30] Sonny, what you think? Stagger?
[44:28:32] Yeah that's what I'm saying!
[44:28:34] Okay. What's harder?
[44:28:36] What's harder difficulty wise?
[44:28:38] A bleed build or a bleed build or stagger build Oh.
[44:29:02] Okay, alright. Chad clapping up for the rebuild of a character?
[44:29:10] ... I just want to beat this shit, bro.
[44:29:21] I just want to beat this shit bro. A nigga said, damn son, who the fuck even uses Tooth Whispers? I hate y'all niggas, man. Oh my god.
[44:30:03] Alright, chat.
[44:30:06] Alright here we go!
[44:30:10] Alright come on, okay step one! So what's step one?
[44:30:14] Yo so all my stagger niggas
[44:30:16] My build was bleed slash stagger
[44:30:22] Bro, all my staggered niggas that gotta help me okay?
[44:30:33] So so staggers is like twigs the black thing.
[44:30:36] So shrinks is L2 Twigs to Black Death. So Shrinks is L2
[44:30:38] so my best one, my best one is mana then
[44:30:42] My best one's, my best one is mana right now
[44:30:44] for the staggers, right?
[44:30:49] Okay Okay Alright bro
[44:30:51] Wait no
[44:31:05] No Fuck. If I'm a stagger, can I still run fast?
[44:31:08] Okay first of all nigga
[44:31:10] I need that weapon right?
[44:31:15] Wait I can't?! Okay, it's not about trying.
[44:31:26] Okay, let's try it.
[44:31:29] Oh my gosh.
[44:31:32] Okay, should we get...
[44:31:32] Let's be real. Should we get the frags first?
[44:31:35] I think we should get the frags first.
[44:31:38] I think we should get the frags
[44:31:39] first. we should get the frags first
[44:31:45] i'm at 18.
[44:31:49] am I 18 but i think we should get Alright Chad, let's do it.
[44:32:06] So strength doesn't increase damage huh? Okay.
[44:32:20] Alright, yo Sonny get the fat list out
[44:32:22] for this stagger build and step by
[44:32:25] step process on how to do it.
[44:32:28] All right so let's go ahead and get chat what's
[44:32:31] the first thing you should which is the first thing I should get?
[44:32:34] What's the first thing I should get? The weapon.
[44:32:50] Okay, what's the weapon?
[44:32:53] Check! Is the weapon that
[44:32:54] the big wooden shit?
[44:32:57] The big wooden shit, with a big circle on top?
[44:33:10] Okay where's it at? Where is it at? It's called the Great Sword.
[44:33:42] It's called The Great Sword. oh like this? So what is it called?
[44:34:04] What's the other one called, Jack?. I'm getting it from Blood Fiend Arm. What's Blood Fiend?
[44:34:06] What is Blood Fiend Arm?
[44:34:09] I don't know. What's blood fiend?
[44:34:10] What is blood fiend arm Oh
[44:34:14] Blood fiend arm, that's what it's called
[44:34:22] Okay, it's this! This is what we gotta use.
[44:34:30] Okay, okay so let's do this real quick. Okay, back. Cool cool cool.
[44:34:54] Okay first thing- okay what's the first thing we need bro?
[44:35:02] ... Oh fuck.
[44:35:09] Skill! Hey, fuck you, nigga. Yo, can you get that please ASAP bruh?
[44:35:29] I need to start getting into my journey.
[44:35:31] Come on!
[44:35:32] Do the other shit!
[44:35:33] So Sunny- Let's Sunny do one thing and then hold on. Let me drop it into my group chat
[44:35:39] Everybody just try to find different shit. Hold on I'm missing the list
[44:35:45] Okay chat! Let me know this is good! Hold on
[44:35:52] Do I need armor?
[44:35:59] Do I need armor? I don't think I need the armor.
[44:36:07] Well, he sent me all this stuff I don't think i need the armor
[44:36:09] But he sent me a whole bunch of shit
[44:36:15] He sent me a whole bunch of shit bro
[44:36:19] It's like mad different shit.
[44:36:22] There was also a way to...
[44:36:33] Uhhhhh Where the fuck is this at? Yo, this nigga sent me a zoomed in ass picture.
[44:36:46] Oh my fucking god.
[44:36:51] Where this, where is it at?
[44:36:53] Oh shit.
[44:36:55] Oh bottom left of DLC
[44:36:58] Wait that's a DLC weapon?!
[44:37:01] What is this a DLC- but that's a dlc weapon
[44:37:08] this is a deal so that's a dlc weapon
[44:37:51] wait that just came out for the DLC? What?. I didn't say BBC. You heard me say DLC.
[44:37:53] You didn't hear me say BBC. Oh my gosh.
[44:38:17] Duke BBC! Nigga, what?!
[44:38:21] How can I talk like this?
[44:38:25] And like... what the fuck?
[44:38:31] Chat do I just have to start skipping over some messages
[44:38:33] that's weird? No imma just
[44:38:35] keep reading out loud so they can hear how crazy that sound.
[44:38:41] I might throw up, check him out and throw up. Where do I go?
[44:39:07] I heard a guy in the town corner. Again, you think I know what a town corner is? yes so so Oh. Oh. so oh these so so oh oh
[44:41:16] illuminati is this man?
[44:41:20] Who just E'ed that nigga ass?! I'm going to get you. What the f-
[44:41:43] Okay, I got it. I got it. Now what's next? Good job!
[44:41:47] Good job, good job. Good job!
[44:41:54] Now level it.
[44:41:56] I can do all that after
[44:41:58] I feel like I think i could do all that after. I feel like...
[44:42:01] I feel like i could do all that shit after
[44:42:03] Wait
[44:42:05] I just wanna make sure we got everything that we need chat
[44:42:11] Okay, what's the best salesman? What's the best salesman?
[44:42:17] Please build. Or am I...
[44:42:19] I'm gonna have to do this again. I'm not sure if that's a good idea or What is this build?
[44:42:22] Or, oh my title's been as good.
[44:42:30] ... I'm not to go back. okay
[44:42:58] okay what do we need to upgrade this bit yeah be done yeah yeah it was like you Yeah, people done. Yeah.
[44:43:04] Yeah it was light work you know now I'm just doing side shit cause I already
[44:43:08] fucked with this game type shit.
[44:43:10] I just love that motherfucker. oh Yeah.
[44:43:31] Chat, Speed said he wants to um. Chat, Speed said that he wants to play chain together after the outer ring.
[44:43:43] He said he wants to play chain together with me.
[44:43:46] I'm like, I can lie! say he wants to play Chain together with me. That might actually
[44:43:49] That's a banger
[44:43:51] We could do it on stream, we can do it on stream
[44:43:53] Yeah we could do it on stream
[44:43:55] Yeah we could, we could Wait should it just be me and Speed? um I think me and Speed, like me yelling at this nigga bro, I would literally chat.
[44:44:28] Chat, I will be so mad bro so so Lottie Laugh with the pocket depreciated. Oh my god, I mean not that I think us to be fire chat
[44:45:10] tell low key just means me and Speed would be like
[44:45:13] because bro it'd be too much going on, bruh.
[44:45:16] It'll be too much going on, bruh.
[44:45:18] And plus we don't have to play.
[44:45:19] And plus oh you need four?
[44:45:21] Wait you need for for sure
[44:45:24] OK, but.
[44:45:26] I'm a I'm a to get out of it, I know.
[44:45:31] And. I don't know.
[44:45:38] Is this it? No, this is it.
[44:45:48] This side as well... I gotta go farm. How much do you did ask the farm chat
[44:45:59] how much like before farm.
[44:46:10] Be this ass and have the rival of God watchin'. Sometimes you gotta pop with a show, niggas.
[44:46:12] But why that song in my
[44:46:14] fuckin' head crazy
[44:46:52] always a pleasure. so I'll be missing bro.
[44:46:54] I'll be missing my nigga!
[44:46:56] I'll be fucking missing bruh!
[44:46:59] I'll be missing, bruh. I'll be missing!
[44:47:04] But I thought... Simba, is Simba in here?
[44:47:05] Simba are you in here?
[44:47:08] Is Simba in here?
[44:47:09] Simba Yonkers!
[44:47:10] Simba, remember when we said we were literally going to beat it under 100 hours.
[44:47:17] Do you remember that?
[44:47:21] Chat, do you remember that? We was at 51 hours and we were like
[44:47:25] Oh damn. We might, we might, we might beat it
[44:47:29] ... beat it
[44:47:33] the fuck happened I don't know
[44:47:39] I thought much rules would be good to upgrade chat like fully
[44:48:17] Anybody can talk about Golden Vow. Somebody find Golden Vow for me please? The Great Sword is also strength builds right?
[44:48:25] Okay so in case this doesn't work Which it is gonna work
[44:48:28] Let me not even be cocky right now
[44:48:34] God, you have no room to be cocky right now.
[44:48:36] Kai, you have no room to be cocky bro.
[44:48:39] You're the only dumbass- Yo how embarrassing is that bro?
[44:48:42] I'm the only... guy... Who's watched their friends move on in the game that's been playing longer wait is this
[44:48:53] the world record for the longest on Radon?
[44:49:01] That we know of right now?
[44:49:05] No way, no way. No way No way
[44:49:06] Shut the fuck up
[44:49:08] There's somebody out there
[44:49:12] In one sitting
[44:49:14] Nah, there's somebody out there no there's no way there's no way
[44:49:23] there's no way
[44:49:25] there's no way so chat um what if like what if some dumb shit happens in it and
[44:49:30] I got bit I get banned on Twitch now what about that been on twitch mid
[44:49:35] mid radon fight are you guys riding I am
[44:49:43] perfect no no no we're not
[44:49:45] no no we don't do that we don't do that
[44:49:47] never mind
[44:49:48] no we don't do that we do not do that we did not do that we don't do that never mind you know if you don't do that we do not do that we do not do that
[44:49:51] we do not do that
[44:49:57] we don't do that. Kick on YouTube?
[44:50:03] Bro...
[44:50:05] Chat
[44:50:07] Kick on YouTube my nigga
[44:50:09] Can you hear yourself? I would just be an IG livestreamer. I think I can make a good rotation to YouTube? Like, if I wanted to one day.
[44:50:33] I don't see myself leaving Twitch though.
[44:50:37] I don't see myself leaving Twitch.
[44:50:39] I think we probably could actually!
[44:50:41] I'm not gonna lie! I think we actually could on the
[44:50:43] Senet Live? I think we could.
[44:50:46] I think we could. We're almost at 10 million.
[44:50:47] Yeah, I think we could bro.
[44:50:49] Like badass lowkey but
[44:50:51] I don't see myself... I just like Twitch chat.
[44:50:54] Twitch just has the best chat.
[44:50:56] Unless you got a contract, brother.
[44:51:00] Brother, I've gotten crazy contracts, brother.
[44:51:04] I've gotten crazy contracts, brother. I've gotten crazy
[44:51:05] contracts, brother.
[44:51:06] It's not about the money, bro.
[44:51:09] One day I'll tell you.
[44:51:10] One day I'll let you guys know.
[44:51:13] No, no.
[44:51:13] One day I'll leak it. One day I'll leak it.
[44:51:14] One day I'll leak shit but not today.
[44:51:20] The rumble was great!
[44:51:22] Hey!
[44:51:23] I fucking love them!
[44:51:25] That was... that was him. That was great.
[44:51:27] That was good.
[44:51:29] That was good.
[44:51:30] That was good.
[44:51:47] That was good. W finale? How did we- HOW?! HOW DID I FINESSE?!
[44:51:55] Now, one day imma tell y'all like, I'm gonna leak some shit and you're gonna be like
[44:52:01] damn what?
[44:52:02] But the day will come soon.
[44:52:03] Don't worry about it. I'm sorry.
[44:52:19] You should have streamed earlier, you know? See, I've got a stream somewhere. Where did y'all stream?
[44:52:27] Really? OnlyFans, Pornhub, TikTok, Facebook. talk
[44:53:05] facebook MySpace! Is my space website even working still? Wait, should we lowkey get
[44:53:23] Hold on
[44:53:24] Should we lowkey
[44:53:25] Get on MySpace
[44:53:26] And get that shit bumping
[44:53:28] Yo
[44:53:32] Yo, should we low key like make a big ass community on MySpace?
[44:53:37] Yo write that down.
[44:53:42] Write that down. Can you pull switches on air?
[44:53:53] No. What is it the most similar to? What app is it the most similar to?
[44:54:03] Ovu! No, OwU and kick back then was fire.
[44:54:11] I'm not talking about the kid that you kids know today.
[44:54:18] That you kids know today,
[44:54:20] I'm not talking about the kid that you kids know today
[44:54:23] I'm talking about Kik
[44:54:26] Alright? K get messages okay?
[44:54:32] Alright
[44:54:42] I think i needed more runes but we'll see
[44:54:49] how much do I need? 12 of everything right?
[44:54:54] Or 1
[44:55:01] 12 of everything up until which spilling stone? 7 or 8? so Oh yeah this is going to be expensive. so wait so asmongold alt chat asmongold only did a fist
[44:56:00] not asmongold i'm bugging moist moist moist so uh Oh my gosh, close. wait
[44:57:21] wiq so oh i don't have does she sell it or no?
[44:57:33] Does she sell it? Where can I get some? Awesome. A dragon? Where's the easiest, where those dragons at?
[44:57:42] Where they at?
[44:57:43] Where they at?
[44:57:44] Where they at?
[44:57:45] What's the easiest dragon chat point to one right now.
[44:57:48] Here? Does he have a dragon here? I can chat points one right now
[44:57:54] Here does he have a dragon here is there dragging it? I don't think so Oh Okay, hello. okay
[44:58:10] now good memory KC.
[44:58:22] That being fucking gamer.
[44:58:30] Fuck! uh so so so so so so I'm not sure if you can see the Oh, fuck. Oh, fuck! The so so wow
[45:00:51] wait he didn't give me shit!
[45:00:59] Broooo! Oh my gosh. What i go where do i go where do i go dlc dragon
[45:01:06] where where where bro wherever where bro where bro where bro where bro
[45:01:23] tell we're Child, where? First area.
[45:01:27] Here or here?
[45:01:31] ... here so I would not do that. Where the fuck are they?
[45:02:13] Wrong one.
[45:02:16] Where? Here?
[45:02:41] Oh! so And here?
[45:02:51] Bro. What?
[45:02:57] Here? Let say it!
[45:02:59] Say what is it called?
[45:03:03] Jack people.
[45:04:47] Jack people. Whoa, what? I don't know. so so I'm going to go down. Am I going up or am I going down? I know I need stones. of stones I can't, i can't i can't this can't be like like i don't understand this i don't understand that she sometimes bro oh my god I'm fighting the wrong jagger, bro. so I'm not sure if you can see the so so I'm fighting the wrong guy.
[45:06:17] I'm fighting the wrong...
[45:06:19] Oh my god, oh my god! fighting the wrong
[45:06:27] My fucking chat is actually ass
[45:06:33] Where where's the normal dragons bro? Where's the normal dragons at?
[45:06:35] Where is the normal dragons at?
[45:06:37] Get me the easiest dragon that has a stone.
[45:06:41] Is there nobody who sells those No bro, I cannot bro.
[45:07:03] I could have sworn that seemed easier to get through. so so Yo! Fire the fucking engine! Yo.
[45:07:36] I'm gonna kill you.
[45:07:37] I'm gonna kill you.
[45:07:38] I'm gonna kill you.
[45:07:39] I'm gonna kill you.
[45:07:40] I'm gonna kill you.
[45:07:41] I'm gonna kill you.
[45:07:42] I'm gonna kill you.
[45:07:43] I'm gonna kill you.
[45:07:44] I'm gonna kill you.
[45:07:45] I'm gonna kill you.
[45:09:01] I'm gonna kill you. I'm gonna kill you. Go! Go! so oh so I'm going to try and get it out of the way. so I am going to try andall can do nothing with this game
[45:09:10] I'm convinced that niggas don't play this game bro. Like, I'm convinced bro.
[45:09:17] You should piss me the fuck off bro and make me get a thousand deaths on something- oh my fucking god bro!.... I don't want to play this anymore, bro. oh oh my life has gone to shit. To shit.
[45:10:50] My life
[45:10:51] has gone to fucking
[45:10:52] shit.
[45:10:54] I'm convinced that y'all, bro
[45:10:56] chat we gotta do better bro
[45:10:59] we have like bro we have to work as a team
[45:11:01] like it's only it's not funny anymore bro
[45:11:06] be direct and be on the same page.
[45:11:10] Where is a dragon shit? Send me to
[45:11:12] an exact dragon that has
[45:11:14] confirmed to drop a blade!
[45:11:34] Why Right now we on tour, we on different page man! I don't know shit, man.
[45:11:36] Oh, God.
[45:11:37] There goes this nigga. Okay. What does Tyler have to do with fucking Elden Ring, my nigga.
[45:11:53] Baird down!
[45:11:54] Baird him, baird him, baird him,
[45:11:55] baird him, baird him.
[45:11:57] Baird him.
[45:11:57] Every dumb shit I see,
[45:11:59] just baird it.
[45:12:00] It's a baird now.
[45:12:01] It's a baird.
[45:12:03] Hold on, Chad. I don't think you understand
[45:12:05] From sun up to sundown
[45:12:07] I've been fighting this n***a
[45:12:09] I am mentally about to lose my shit
[45:12:11] You understand me? I'm mentally
[45:12:14] frustrated. Let me put into perspective
[45:12:16] on what's going on, bro. Sonny, in the
[45:12:18] meantime, just have everything listed out, please.
[45:12:21] Just please list
[45:12:22] out all the best things that I need
[45:12:24] Just list it out and just have everything
[45:12:27] Prepared and have what a text or two mods come together as these fucking Avengers, and you guys just help
[45:12:50] Help me. I need avengers and you guys just help help me i need it i want it i need it Now, Chad Let's rekindle
[45:12:52] Let's calm down for a second
[45:12:54] Everybody just take a break Let's calm down for a second. Everybody just take a break, man.
[45:12:57] Just calm down, bro.
[45:12:59] Just calm down for a second, okay?
[45:13:03] Just calm down.
[45:13:06] Everything was a misunderstanding
[45:13:07] Relax
[45:13:09] Let's work to beat this game
[45:13:11] Then we can have all the fun in the world after that
[45:13:13] Who gives a fuck? I'll throw a club
[45:13:15] In my room after I beat the game. I don't give a fuck.
[45:13:18] Whatever y'all niggas want, we will do it bro.
[45:13:22] We can't get no Travis Scott stream if
[45:13:24] we gonna be on this motherfucking game. You wanna know why?
[45:13:26] Cause we gon' be here.
[45:13:32] I can't plan out and do the things that I want to do for the summertime,
[45:13:34] Wanna know why? Cause we gonna be here. In two days, I really got to do some crazy fire shit.
[45:13:47] And if I miss this opportunity,
[45:13:49] I'm going to be very upset bro.
[45:13:54] So let's all just come together as one
[45:14:01] and fight against Madan!
[45:14:04] Let's build what we gotta build, get in there and get out!
[45:14:09] Let's enjoy the ending whatever the is, however the fuck it ends.
[45:14:15] Let's go to Sekiro. It's a bad day.
[45:14:36] See this is why, hey get the fuck out of the classroom then nigga.
[45:14:40] You can't even take shit serious in China.
[45:14:43] What the fuck is he talking about, son?
[45:14:45] Yo, ban that nigga!
[45:14:47] Ban him, ban his mom
[45:14:49] Ban his little brother
[45:14:50] Ban his sister
[45:14:51] Ban everybody he's associated with.
[45:14:53] You wanna know why?
[45:14:54] Because he wants to joke around.
[45:14:56] Get the fuck out of here!
[45:15:01] All right.
[45:15:26] Let me go. I haven't smoked one of these in so long. I haven't smoked a pack on a nigga.
[45:15:41] I haven't even smoked,
[45:15:42] I haven't rolled up anybody in such a long ass time bro.
[45:15:54] Oh. anybody in such a long ass time, bro. It's alright.
[45:15:55] Racing time. Let's go. Let's get it. Let's clean up side racing time area just chill It's really kinder. Let's get apart area
[45:16:10] Just chill okay
[45:16:16] All right chat what's up? Hope you're having a great day try hope we have anything
[45:16:19] We'll hope you're having a great day. For real, Hope you're having A great day for real bro.
[45:16:20] Alright?
[45:16:23] Hope your family's doing good.
[45:16:24] Hope you're doing good.
[45:16:26] Hope your girlfriend Or your boyfriend ain't cheating.
[45:16:27] I hope your whole life is great.
[45:16:28] Okay?
[45:16:30] I hope, I hope you're great okay i just hope
[45:16:33] you good and i love you bro well sometimes it may be hard on y'all
[45:16:37] you know sometimes we maybe hard but i I just know it's all love bro.
[45:16:42] This is what we gonna go through.
[45:16:44] Okay?
[45:16:50] Like a little toxic relationship.
[45:16:54] Alright?
[45:16:58] Be friends though.
[45:17:00] I can't say nothing?
[45:17:03] There's nothing I can say?
[45:17:05] There's nothing I can say?!
[45:17:08] ...
[45:17:19] ... Okay, come on. We're at a thousand deaths now.
[45:17:21] Alright? Let me go to Rekindle real quick.
[45:17:24] Let me text my mom
[45:17:25] and make sure she's good. Oh, I
[45:17:27] broke more glass! Wow.
[45:17:30] Um, I got an Amber Alert
[45:17:31] it says 2024 Black toyota camry hold on chat Stop wasting time! It's gonna be 4-4-4. Things are looking good.. I'm telling you, that Popeye didn't show niggas. Yo crying.
[45:19:23] One more step. chat one more all it takes is one more and then I'm going to start tweaking.. All right, all right. Lock in!
[45:19:24] Lock in.
[45:19:25] Okay.
[45:19:26] All right, let me put this here.
[45:19:27] Put this here.
[45:19:28] Let's put this here.
[45:19:29] I think it's going to be good.
[45:19:30] I'm not sure if you can see the screen. It's a little bit blurry. I don't know what that is. put this here Okay. Let me put this here.
[45:20:28] Alright, let's go. so Alright. Yes, yes do I want it?
[45:20:32] Yes! It's all obvious questions, yes.
[45:20:35] Yes, yes, yes, yes. Where?
[45:20:43] ... Top right red area, non-DLC.
[45:20:47] You hear the guy in there?
[45:20:50] Top right red.
[45:20:53] Top right left. This!
[45:21:05] Okay Thank you chat, thank you chat Okay.
[45:21:07] Okay, thank you chat! Thank you ch-chat!
[45:21:09] Thank you okay now we're moving.
[45:21:11] Okay everybody's saying yes at the same time.
[45:21:13] Thank you.
[45:21:15] Okay.
[45:21:21] I was just here nobody nobody turned up. Alright, no one.
[45:21:24] I think i beat him already.
[45:21:26] Oh no I didn it! Okay, cool. so so so I'm not sure if you can see the so so so. Oh!
[45:23:07] Okay.
[45:23:11] Okay, what's this? Okay.
[45:23:17] It was him, okay.
[45:23:21] Okay.
[45:23:46] Okay. Where? Him? That's not Valak, if you're lying.
[45:23:52] Oh my fucking god! so I'm not sure if you can see the so so so so so so so I'm going to have to do this again. Thank you, water. Why are you saying no? okay I know I'm done with this main story right yeah do you know I'm done
[45:26:26] with the fucking reading story, right?
[45:26:31] I don't give a so Now...
[45:27:05] Yes sir! Next.
[45:27:07] What's next? What's next? What's next?
[45:27:09] What's next?
[45:27:10] What's next?
[45:27:11] What's next?
[45:27:12] What's next?
[45:27:13] What's next?
[45:27:14] What's next?
[45:27:15] What's next?
[45:27:16] What's next?
[45:27:17] What's next?
[45:27:18] What's next?
[45:27:24] What's next? What's next?
[45:28:12] Golden Vow so so Hold on, Sonny sent me it. What is this? Sonny you gotta...
[45:28:14] Oh, 452.
[45:28:18] 452.
[45:28:22] Okay. Is this the original map or what?
[45:28:38] I don't even have the fucking... Wow, I don't even have the grace from here.
[45:28:43] That's crazy.
[45:28:45] Damn, chat!
[45:28:47] Damn chat, my pathetic ass don't even have the grace mirror.
[45:28:51] Damn chat...
[45:28:54] Did he beat Rodan?? You guys can chat. Oh shit! Oh shit, he's actually on my side.
[45:29:20] No I didn't beat him,
[45:30:57] I didn't beat him so What the fuck is that?. I didn't need that, brother. downstairs Downstairs? I can't, not today. so What am I looking for?
[45:31:08] What was that even for again? Child, what's
[45:31:09] that for again?
[45:31:11] I need a Levar too.
[45:31:16] Sonny, what are you sending me for?
[45:31:19] What is this?
[45:31:20] Sorry, I don't understand.
[45:31:29] Oh. Sonny, what are you sending me today? I have it.
[45:31:32] It's right here.
[45:31:36] This?
[45:31:38] THIS?!
[45:31:46] Okay, another thing in my bear... Okay, another thing you might be aware of... I'm here. crack
[45:32:22] please Okay.
[45:32:32] Okay?
[45:32:36] Okay!
[45:32:41] Oh wait, hold on though! Damn so I can't get any... Okay. I might not...
[45:32:43] Okay?
[45:32:49] ... Okay. Tell me, what's today's date?
[45:32:51] What day is it?
[45:32:53] Oh, okay.
[45:32:55] I'm going to go with the same one as last time.
[45:32:57] Okay.
[45:32:59] So, we're going to do a little bit of a Okay.
[45:33:03] Tell me, what's todays date? What day is it?
[45:33:05] Oh my god, what day is it?
[45:33:13] Highest elect of grace, kill the rolling guy and then I saw his statues.
[45:33:16] Left of Grace...
[45:33:23] Kill the rolling guy and then... In there is switch stashes. Here?
[45:33:27] Left from police
[45:33:35] From left to right I'm not sure.
[45:34:27] That's it? so That's a boar. Holy shit!
[45:34:31] And now what? so I don't even have the grace for this.
[45:34:52] There's two graces I'm missing from here.
[45:34:58] Should I go from this one? And there's two places I'm missing from here.
[45:34:59] Should I go for this one?
[45:35:02] Or this one since it goes up and around? Go for me, mate.
[45:35:19] What level am I at? so so so I'm telling you, Chad. Where did I go? up here Up here? Behind that building? Did he beat him yet?
[45:36:58] What the fuck do you think?
[45:37:00] See, my whole chat is on one page.
[45:37:02] Thank you, chat.
[45:37:03] Holy shit.
[45:37:04] My whole chat is literally
[45:37:04] on one page right now.
[45:37:08] Holy shit. I'm doing doing good let's see how long this last so so I gotta go in here. so I'm not sure if you can see it, but the enemy is moving. I don't know what to do with this guy. I'll try to get him out of here. run it so Yo, Chad, not even this much...
[45:38:47] Chad, not even...
[45:38:48] Chad.
[45:38:49] Chad!
[45:38:50] Not even Batman gives as much prep time, huh?
[45:38:54] I know, brother? I know bro.
[45:38:55] I know.
[45:38:56] I know.
[45:38:57] I know.
[45:38:58] I know.
[45:38:59] I know.
[45:39:00] I know.
[45:39:01] I know.
[45:39:02] I know.
[45:39:32] I know. I know. so so I think that's the one. It's okay? No, no, no! But is it though? Is it okay like is it Am I missing the grace? so so so so so. Oh shit. Is that this one? No, what I gotta do?
[45:41:01] What I gotta do?
[45:41:02] I'm gonna go to the other side.
[45:41:03] I'm going to try and get out of here.
[45:41:04] I'm not sure if it's safe or not.
[45:41:05] I don't know.
[45:41:06] I think we're good.
[45:41:07] We got a lot of people in there.
[45:41:08] I'm just trying to make sure they don't see us.
[45:41:09] I'm just trying to make sure they don't see us.
[45:41:10] I'm just trying to make sure they don't see us.
[45:41:11] I'm just trying to make sure they don't see us. I'm just trying to make sure they don't see us. I'm just trying to make sure they don't see us. got this one
[45:41:34] no what do i gotta do what am i gonna do i gotta kill him I'm so...
[45:41:42] Okay hold on, hold on
[45:41:45] Hold on
[45:41:45] He wants attention
[45:41:47] So let's give him attention
[45:41:49] Let's give him attention
[45:41:50] So let's give him attention
[45:41:53] Let's give him attention, chat. Let's give him attention.
[45:41:55] He wants attention right?
[45:41:59] Message from Jinxy
[45:42:09] Hey I think the goal is to defeat Radon.
[45:42:15] Three days is crazy! You're not a gamer. A thousand deaths at MFAO. Jinxy, you're a quitter!
[45:42:21] You are a quitter!
[45:42:24] You quit on the fucking boss nowhere near the fucking end.
[45:42:29] You're a quitter, you quit!
[45:42:32] You quit! Do you understand that?
[45:42:35] You literally quit, Jinxie!
[45:42:38] You fuckin' pipsqueak!
[45:42:41] Talk about I'm not a gamer, nigga. You don't have the dedication.
[45:42:43] You don't have the drive.
[45:42:45] You don't have the motivation.
[45:42:46] You don't have the mentality. You don't have the mentality.
[45:42:48] You don't have the drive to do whatever
[45:42:50] fuck that you wanna do, why?
[45:42:52] Because there's so...
[45:42:54] You're in a box!
[45:42:56] You're in a box!
[45:42:57] You can't fuck with me when it comes to this Elderling shit.
[45:43:01] I don't even fucking know how much times I died...
[45:43:04] ...I never gave up.
[45:43:08] I NEVER GAVE up. Ever!
[45:43:12] So before you laugh,
[45:43:15] Before you text me
[45:43:17] And before you analyze how crazy the depth is and everything
[45:43:20] How do we miss?
[45:43:22] Always remember that you quit
[45:43:27] Quick
[45:43:30] You actually quit. Q-U-I-T. That's something that's not in my blood, it's not in my DNA. I'm not even familiar with the word.
[45:43:44] Okay?
[45:43:46] So sit down, okay?
[45:43:48] Sit the fuck down!
[45:43:50] And I know you don't know this shit because...
[45:43:54] Truthfully, it's not about how many deaths you have.
[45:44:00] It's not about the amount of hours you have.
[45:44:02] It's not about how hard the game is.
[45:44:04] The real question is, will you give up?
[45:44:09] Are you making progress?
[45:44:11] Do you have the dedication?
[45:44:18] And when I beat this,
[45:44:22] Imma smoke a blunt on madone a cigar on madonna and imma smoke one on you
[45:44:37] okay Hey! Bitch.
[45:44:43] Why is he laughing? I actually cannot laugh, bro! I
[45:45:03] Can't laugh like why does he keep laughing? Hold on, just in case Jinxie doesn't know chat I'm gonna have somebody tell them okay
[45:45:21] just in case jc doesn't know hold on okay i might have somebody tell them.
[45:45:36] ...is out in a couple days over on......the Tree Sentinel.
[45:45:37] People talking about how embarrassing...
[45:45:39] People were clowning Kai and, and like really blowing it up that he's died
[45:45:41] hundreds of times on the Tree Sentinel.
[45:45:43] People talking about how embarrassing that is,
[45:45:45] See here's the thing what's embarrassing
[45:45:47] is to actually quit the game and not beat the game. That's the embarrassing
[45:45:50] part. Giving up is the embarrassing part. He didn't
[45:45:52] give up that entire time. Also, I'd
[45:45:54] argue that without that fight, he wouldn't
[45:45:56] be even half the player that he currently is.
[45:45:58] Doing that fight and conquering that is a huge part
[45:46:01] of player development right there. He learned how to
[45:46:03] actively one hand, two hands, when to swing
[45:46:05] when not to swing. Could you imagine if he did
[45:46:07] Pretty embarrassing bro
[45:46:08] Pretty embarrassing And you're a gamer
[45:46:13] and you're actually a gamer oh and he's ACTUALLY a gamer!
[45:46:24] OHHHHHHH Get the fuck outta here kid
[45:46:28] Nigga you get- nigga you get- niggah
[45:46:30] Nigga, you get carried by stomping, nigga.
[45:46:33] Yeah, nigga.
[45:46:34] You get carried by all them niggas.
[45:46:35] Every tournament I watch,
[45:46:36] you're getting carried
[45:46:37] every single fucking time.
[45:46:39] You understand me, kid?
[45:46:40] You get carried all fucking day
[45:46:42] bottom of the leaderboard.
[45:46:43] Yeah...
[45:46:45] You're that cheerleader boy!
[45:46:48] The fuck is you talking about boy?
[45:46:50] The man in the bottom of the leaderboard on Rainbow Six Siege nigga
[45:46:53] You got the most emotion on that shit but you still in the bottom.
[45:46:56] Fuck is he talking about?
[45:46:58] Stompin's better.
[45:47:01] Okay?
[45:47:08] Stomp it's better
[45:47:17] forehead shiny as fuck that's not the point okay all right where'd I go would I go
[45:47:27] that's gonna piss him off, chat. That's W bait.
[45:47:28] Chet that's a good bait.
[45:47:29] That's a good bait.
[45:47:30] That's a good bait.
[45:47:31] That's a good bait.
[45:47:32] That's a good bait.
[45:47:33] That's a good bait!
[45:47:34] That's a good bait!
[45:47:35] That's a good bait! Chet that's a good bait. That's a good bait! That's a good bait! That's a good bait! That's a good bait!
[45:47:38] Said that's a good bait!
[45:47:44] Hold on...
[45:48:36] Uh, DM for the next shit, you see?. Um... Oh oh shit. Oh, LeVar's here. I'll be back.
[45:48:38] LeVar Balls. Hold on. The bar balls. Which Grace?
[45:48:56] This one, which grace is bad to go to? to i don't know
[45:49:11] oh this and then around? I'm gonna go to the bathroom.
[45:49:32] Is Jake's here? I gotta, I gotta, I gotta
[45:49:34] hold on, hold on. I have to
[45:49:38] wait I have to VIP him
[45:49:42] ... so JT type?
[45:50:02] JT type?
[45:50:09] Change title to radon slaps me around day four hey your next shadow hey pay some homage to your father stomping
[45:50:15] your next tournament pay some homage to your father stomping your next tournament pay some homage to
[45:50:17] your father's stopping and the whole group
[45:50:24] i can't even talk shit!
[45:50:29] Oh my gosh.
[45:50:33] Okay, yo your next tournament that you do
[45:50:35] from 1pm to 10 pm or your next 24 hour
[45:50:40] that you don't do or your next marathon that you don't
[45:50:44] complete
[45:50:47] you pay homage in the title and you put
[45:50:49] make sure that you put
[45:50:55] Father Stomping
[45:51:01] Father stomping Stomping Father stopping this you know I told him that WGC chat
[45:51:14] Jinxy! First of all
[45:51:18] bitch, wait no nah. Chat, Jinxy is actually
[45:51:21] fake as fuck
[45:51:23] But me, Jinx and Sketch are supposed to
[45:51:25] um... chat
[45:51:27] Me, Jinx and Sketch are literally supposed to do a stream
[45:51:31] He's actually fake as fuck.
[45:51:35] Nah, I ain't gonna lie, JigCy,
[45:51:37] you pissed off the Souls community with that one bro.
[45:51:39] JigCy! I'm'm not gonna lie you quitting that
[45:51:43] you should never did that like one thing that i noticed about the souls community
[45:51:48] boy this is life bro this is their light like this is life game these games are
[45:51:53] like precious stones like they're like precious eggs bro so you can't even play
[45:51:58] with it like story mode or like you feel me okay hello where's that oh yeah now real shit I
[45:52:09] learned at the hard way to after beat the first one
[45:52:13] I learned that like
[45:52:15] Soul games bro
[45:52:16] Once you start it
[45:52:17] You gotta finish it
[45:52:18] And their community is big as fuck
[45:52:21] The soul community is huge
[45:52:23] I think
[45:52:23] The soul community Who huge. I think the Soul community, I'm a... Who has the biggest community?
[45:52:27] Probably like GTA or like but a specific genre? No nah I'm talking about like
[45:52:36] gaming community. Game community game community
[45:52:40] Minecraft community is deep yeah Cod community is pretty deep yeah you're
[45:52:44] right you're right you right, you're right, you're right, you're right, you're right.
[45:52:46] You're right, you're right, you're right.
[45:52:48] You're right, you're right, you're right.
[45:52:54] Fortnite? Nah I don't think so.
[45:52:55] I don't think... Is it?
[45:52:57] Nah, it is. It is.
[45:53:01] It is.
[45:53:03] I don't know though.
[45:53:05] Bro the Souls community is deep bro,
[45:53:06] I'm telling you this.
[45:53:08] Trust me chat.
[45:53:13] Oh yeah! The 2K Community!
[45:53:14] Yeah, yeah, yes, the 2k community.
[45:53:17] Yeah, yeah, yeah, the 2K community. Yeah
[45:53:17] Yeah
[45:53:18] Yeah yeah yeah yeah
[45:53:23] Lookin' ass
[45:53:24] 2k is fuckin dog shit
[45:53:25] Hey Ronnie
[45:53:26] I would never
[45:53:26] Hey Ronnie
[45:53:27] I don't give a fuck no more bro Ronnie I don't give a fuck no more, bro.
[45:53:28] Ronnie, I don't give a fuck. Before I gave a fuck,
[45:53:31] now I don't, bro. You literally let me...
[45:53:32] Ronnie, you had me fly to Vegas
[45:53:35] to do a fucking
[45:53:36] face scan and didn't even put me in the game but you know what i had
[45:53:39] to do that day and i came all the way to vegas and flew out that same night like bro this thing
[45:53:44] is so inconsiderate bro like damn my like i don't give a fuck no more bro.
[45:53:51] I don't give a fuck bro.
[45:53:53] You piss me off bro.
[45:53:55] Your game is dog shit bro.
[45:53:57] Nigga had me fly to Vegas.
[45:54:01] Nigga I paid for my own fucking hotel! My own
[45:54:03] flight! Where I'm going, chat?
[45:54:05] Where I'm going, bro? I don't even wanna get mad right now.
[45:54:07] Where I'm going? Did promo
[45:54:09] for the game!
[45:54:11] Like, yo!
[45:54:12] Hey, fuck you, Ronnie!
[45:54:13] Fuck you!
[45:54:14] Fuck you!
[45:54:15] Nah, don't go fuck, bro.
[45:54:16] I'll be seeing you in real life and shit.
[45:54:17] You'll be at certain events.
[45:54:18] But fuck you, nigga.
[45:54:23] Nah, deadass, but that shit is pissing me off, bro. the memory jeans Monica where I'm going chat but a naked let me go to Vegas face can touch ghost sitting in
[45:54:30] chair touch ghost sitting in chair Wait, where? So, I'm buggin'? Am I blind? East. Wait, am I fucking...
[45:55:40] Right.
[45:55:44] Oh, weird!
[45:55:49] I've been in this get the two more, bro
[45:55:56] Well that's good drip.
[45:55:58] OH! Oh what the fuck?
[45:56:18] Pffft I Check let's be
[45:56:21] Check let's be wise
[45:56:30] Hey Okay.
[45:56:35] Dex 11, 816 Arc 16
[45:56:36] Is it thy wish?
[45:56:41] Now i wish now
[45:56:45] text 11. my desk can be 11. Oh fuck
[45:57:03] Okay, you pin it we put it we put it wait hold on be careful wait 60 strength
[45:57:13] 60 begor 60 for core
[45:57:34] this is my arcane should be higher Alright, where should my endurance be chat? Where should my endurance be?
[45:57:40] What do you think is a good endur endurance. 30 to 35s?
[45:57:51] My mind should...
[45:57:53] Where should Arcane be? I think my mind should be higher no
[45:58:01] okay should be what 60 but my arcade should be 60.
[45:58:10] oh this is a 60 plus so what can i take off. Let's have 40 arcane.
[45:58:41] 40 Arcane and then put it where?. Like this?
[45:59:13] Oh mine, mine.
[45:59:24] Like this? Hold on, where was my mined nat?
[45:59:36] Hold on, where was was it at just now? angels now
[46:00:01] it's gonna be like this?
[46:00:17] Okay, 40. Chat pray! Pray, pray! I'm going to use the power of my son. fine GG's.
[46:00:57] You gotta spin this thing to level it?
[46:01:01] To level what, to level what?
[46:01:05] To level what? You got spin this on to level it so number what's never what it's another one
[46:01:14] Oh the sword no, its max's Max! It's Max.
[46:01:18] It's Max right chat?! My Sword is Max!
[46:01:24] I think it's Max- It disappeared when I clicked it.
[46:01:31] Wait, no...
[46:01:35] The ancient smithy
[46:01:39] Him? living here
[46:01:44] gang i'm telling you it's max 10 is max right? Yeah, this is Max. I'm going to go ahead and do that. know when a build is good when i go below that 50 if i go below
[46:02:32] that 50 hour level all right revamp
[46:02:37] so equipment this in hand. Take this off.
[46:02:47] Put dagger in left-hand... Where's the dagger at?
[46:02:54] What dagger?
[46:03:02] ... Where?
[46:03:11] Up.
[46:03:13] Right here?
[46:03:14] Dagger left. up right here left and then
[46:03:23] and then what else?
[46:03:25] Add algebra and go to round out.
[46:03:28] Wait, wait, wait! What about my physics?
[46:03:34] ... Add Ashervore.
[46:03:40] Okay, hold on.
[46:03:42] Ashervor...
[46:03:46] Hold on, Ashervor, Ashervor, hold on I'm thinking, I'm thinking, I'm thinking.
[46:03:48] How do I do that?
[46:03:59] Which one?
[46:04:03] Golden Vow?
[46:04:04] Sacred? Okay. No, dang it.
[46:04:13] I don't think we have it. Oh, right here.
[46:04:24] Which one? Main hand gets Crag Blade.
[46:04:33] Blood.
[46:04:35] Main hand gets Crag Blade?
[46:04:38] What do you mean? Main hang is crack blade.
[46:04:42] What do you mean?
[46:04:54] Give dagger golden bow. What do you mean, give dagger?
[46:05:09] What?! Oh, dagger.
[46:05:11] Oh! sacred.
[46:05:14] Sacred.
[46:05:19] Okay now how do I do my flask?
[46:05:23] Oh yeah okay which one should I put on? Which ones do I put on?
[46:05:37] Now this bell grant me strength. Learn to spell, grant me strength.
[46:05:41] So leave HP on, right? Add physics spike cracked
[46:06:02] okay
[46:06:04] take off HP
[46:06:14] and put what? Opaline?
[46:06:17] Yeah, probably right.
[46:06:25] Okay... Okay, now I need more mana right?
[46:06:33] More Mana Flask.
[46:06:34] So I should just add one more or add one. No?
[46:06:49] Two.
[46:06:53] I don't need it for real?
[46:06:57] When I...okay, so what is my best friend I don't need it for real?
[46:07:03] Okay, so what is my best friend for this weapon? Is L2 my best friend?
[46:07:19] Oh, so what is it r2 and then you are using hearts, okay? and then...
[46:07:23] Then none grand-
[46:07:25] How do you do that?!
[46:07:27] How do you do the Grammy strength?
[46:08:13] BOOM me strength So what's the first one? links And what else? Then tailsman. Oh yeah, tailsman, tailsman. It's not magic! Tell you what I cannot trick me anymore, bro.
[46:08:25] This is my first...
[46:08:27] I actually watch Elden Ring.
[46:08:29] I watch Elden Ring, bro.
[46:08:31] I literally watch Elden Ring.
[46:08:37] Um um you still didn't get one tells me you need to get it where's that send it to me chat remind me when I take a break to watch XXL
[46:08:55] okay
[46:08:55] I haven't seen anybody break to watch XXL, okay?
[46:08:58] I haven't seen anybody that's on XXL.
[46:09:12] I just scrolled past it. chat you see this is what happens when I'm on like
[46:09:14] see I'm on twitter
[46:09:15] some dumb motherfucker just said like see i'm on twitter i didn't get a twitter
[46:09:18] some dumb motherfucker just said because i unfollowed out the disrespect right
[46:09:22] he just said was just hanging out with a girl in
[46:09:26] middle school north he has absolutely no room to talk about
[46:09:31] this the fact that you think like that means that there's something wrong with you
[46:09:39] there's something wrong with you. There's something
[46:09:40] wrong with you.
[46:09:43] Like,
[46:09:44] like mentally though.
[46:09:46] Like mentally.
[46:09:55] Like Like, mentally. Actually!
[46:09:57] The app is cooked, chat.
[46:10:01] I ain't gonna lie lot Twitter's cooked. That's why I don't like being on it bro
[46:10:05] It's a hate me though and there's a lot of positive people
[46:10:09] On twitter too no cap. There's a lot of positive people on Twitter too, no cap.
[46:10:12] There's a lot of positive people on Twitter too. But bro, like
[46:10:14] what the fuck?
[46:10:20] But the negative outweighs the fucking...
[46:10:22] We have to go in a small hole?
[46:10:26] In a wall again?
[46:10:30] Where, where, where, where?! Where? so so say drink y'all got into my room so Do I go up?
[46:11:39] Yo, it's good gang. I won the game. Fuck you mean I'm not gonna beat it nigga?
[46:11:46] Nigga! I literally on the last motherfucking shit! I'm gonna keep playing that shit like this is charity.
[46:11:49] I mean, see bro? That's the change in your game play.
[46:11:56] You're dead. more shit and I'll get my character bro
[46:12:00] i gotta upgrade my character bro tune in imma beat him tune in tune in
[46:12:08] tune in 2 in him bro Not even 30
[46:12:11] 95
[46:12:11] Oh like
[46:12:15] 30 hours on him though I'm glad
[46:12:16] But I'm going to call you when i beat this shit all right j-pop
[46:12:25] check where i'm going going
[46:12:41] oh my god Oh fuck off! Die nigga! Die nigga! DIE! DIE!
[46:12:49] DIE DIE DIE DIE DIE DIE DIE die die die die die die Die! Die! Die! Die! Die! Die!
[46:12:59] Grace higher? Damn. I can't even grace out this bitch. Damn.
[46:13:15] Do I go up chat? Somebody said that better not be the damage.
[46:13:38] Somebody said, what? That better not be the damage! Better than I've been this...
[46:13:49] Yoooooo! It's not, it's not. It's a fucking- I'm using the dagger that's why.
[46:13:51] Alright where do I go? Can I- Sonny can
[46:13:53] I just go to it from here or no? No I can't. Which one? Which one? Which one?
[46:14:26] Which one?
[46:14:27] This one?
[46:14:28] I'll get this one.
[46:14:29] Mmmmmmmm.
[46:14:30] I'm going to go struggle bro is this funny money
[46:14:46] yeah dumbass niggas well shit is not funny funny. I don't know why y'all be like, alright nigga just kill him
[46:14:53] Nah when i was watching Mark that nigga looked like he was ready to just not even play no more
[46:15:01] bro.
[46:15:02] He look like he was ready to get the fuck up out of there. i don't know so so help Help!
[46:15:52] I can't even open up my map.
[46:16:01] I couldn't even open up my map! Don't worry, I'm not blind.
[46:16:19] I go up
[46:16:31] and all the way up
[46:16:57] All that over there has to be I don't know why they explore it. Help.
[46:17:05] Help! You got it! Got it.
[46:17:10] There you are, ready? 1-0-0-3 One zero, zero two.
[46:17:23] Now you ass for real.
[46:17:27] All right, man. I
[46:17:37] But if this don't work, we're doomed.
[46:17:56] Another lie! Another lie! But if this don't work, weisman. Talisman is what?
[46:17:58] Axe.
[46:17:59] So not jump right no jumping and then what else what else did I get
[46:18:04] damn which I change this this this or this
[46:18:22] wait talisman at the axe two hand and Golden Bray. I need the axe, 2hand and golden bray
[46:18:24] So this is gonna stay
[46:18:29] This one's gotta stay
[46:18:30] Okay hold on hold on hold on, hold on, hold on, hold on.
[46:18:33] Chat, which one do I take off?
[46:18:35] This?
[46:18:36] Great jar?
[46:18:42] It makes me run faster.
[46:19:19] Golden parade dragon chest armor Golden Prairie Dragon Chest Armor. This one I'll put on with this little hand. and then what else chat
[46:19:25] claws goopers dagger wait claws good for stagger. Wait, claw is good for stagger?
[46:19:45] And then left hand slot to put finger seal left hand slot tool left hand Left hand.
[46:19:51] Left hand's got to put finger...
[46:20:42] Which one with that? so which one is it what like what What's a seal?
[46:20:43] I don't know what a seal is.
[46:20:45] Oh.
[46:20:48] A golden seal.
[46:20:49] What does this help with?
[46:20:53] Which one is better, the golden the garden or the seal or the dry leaf seal
[46:21:05] oh And then...
[46:21:23] That's it and how do I activate my actual war I equipped it You can't use that one
[46:21:31] Not enough faith
[46:21:31] For the round table
[46:21:32] Holy shit How much Use that one, not enough faith for the round table.
[46:21:36] Holy shit I'm a...
[46:21:44] Who am I going to talk to at the round table?
[46:21:47] Twin ladies, fuck.
[46:21:54] I'm probably broke, most likely I'm broke. Chat watch. I might walk into this bitch broke. Look.
[46:21:58] You got zero dollars. Have a good night.
[46:22:01] What what what what what what what is it called
[46:22:09] with the call Second, bottom, low, middle. Oh, it's one-time uses though. Almost almost not Use this one?
[46:23:17] That one? Upgrade it.
[46:23:23] Oh, I need wounds to upgrade it.
[46:23:29] Bro, bro, I'm some broke ass Wait, what?
[46:23:48] So now what? Now what? He was dead too. Use that to bust.
[46:24:05] Okay, how do I activate my buff? Take out seal
[46:24:25] L
[46:24:27] Wait what
[46:24:29] Take out seal
[46:24:32] L1 left D pad
[46:24:34] L2 Y Take out seal L1 left D-pad
[46:24:34] L2
[46:24:36] Why R1?
[46:24:39] Nigga are we playing GTA?
[46:24:42] L1 Left D-Pad, L2 I won't let be bad else Now what fuck now what
[46:24:57] up in those the
[46:25:05] why YR1
[46:25:07] YR1
[46:25:32] YRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR Well, he tented in rolling it. Oh, fuck.
[46:26:14] Whoa! Why am I spamming Null? Why are everyone on two different Bad running. Man, my chat gotta be the dumbest chat ever!
[46:26:18] Who is right? Am I too ahead bro?
[46:26:22] Am I too ahead in this shit, what am I doing?!
[46:26:28] Damn! um like this right Oh my gosh, bro.
[46:26:55] Then it's this.
[46:26:57] Then it's this.
[46:27:00] Then it's this.
[46:27:04] Like... is this like
[46:27:40] bro i swear to god bro i swear to god i swear to god yo i swear to god bro these are simple instructions on god I would say... and
[46:27:53] the My one hand is the dodger. Yes, thank you.
[46:27:55] Like that's what needs to be said bro
[46:28:03] fuck
[46:28:07] what the What the f-
[46:28:13] Oh?
[46:28:27] Ahhhhhhhh Now what? Now what? now what now what
[46:28:35] oh my fucking Oh my god, I fucking hate this shit.
[46:28:46] I swear to God, I hate this shit, bro.
[46:28:47] I hate this shit, bro.
[46:28:49] I hate it so fucking much. I hate it so fucking much.
[46:28:51] I hate it so much, bro.
[46:28:53] I can't do this no more, bro.
[46:28:55] I can't.
[46:28:58] I can't do this no more, bro. oh so so so so I had to hold it.
[46:30:02] Had to hold it?
[46:30:12] Like this?
[46:30:39] The so What? What?!
[46:30:44] What the f- Boom
[46:30:53] My nigga
[46:30:54] Yo
[46:30:56] My nigga
[46:30:57] I can't
[46:30:58] I can't I can't I can't yo
[46:31:00] Can somebody?
[46:31:01] Type out pin a random viewers come out of the fuck
[46:31:05] Somebody correctly type out the exact way to do it please please please please holy fuck Just spin around if you want to! so I'm starting to like this game.
[46:31:59] This just did us a piece of video. so so
[46:32:32] keep it being moniker I'm running this. so I'm not sure if you can see the so so so so so so I'm not sure if this is the best way to do it, but I think you can just go with what's in your inventory.
[46:34:28] I don't know why they're doing that here... I'm not going to die here. Hey, fuck! I got greedy, I got greedy, I got greedy.
[46:34:46] I'm going to just steal every time.
[46:34:51] Put dagger in second slot, right hand.
[46:34:55] It'll make it easier.
[46:34:58] Just keep what I've been doing, Pinn please.
[46:35:02] Okay so...
[46:35:33] So alright so... Okay, so he... So take this off. And put that there Rawl Dagger.
[46:36:01] What? what what uh why is he so confusing so so I'm not sure if you can see the so so That was a south, that was actually a son of a bet.
[46:37:29] Yo!
[46:37:30] My nigga AJ! Yeah, well they get aged it bro nigga. I went to LA came back
[46:37:40] Still on the same ball. Yo, wait a while you see with that later, bro
[46:37:45] Just waiting. It is way like same boss? Are you fucking serious? Wait, why didn't you tell me to go to LA though bro? I just went.
[46:37:47] But man, but why didn't he tell you? You would be a W woman and be like
[46:37:49] Hey! Yeah well when are you gonna get up
[46:37:51] and finish your drunken outing ring brawn no you don't
[46:37:53] No, he was gonna come over there and say hey, I't go to la oh you want me to say bye before
[46:37:55] i like it when you're asleep how was it though it was great it was great bro we had a it was
[46:38:00] a movie we did this in venice it was nuts no glaze no glazed chat I didn't even know you was here
[46:38:07] I was like, wait hold on, son smells good
[46:38:10] I swear to god, like mid-bite
[46:38:12] I'm like, son smells
[46:38:14] good, he smell good. Oh thanks man, appreciate it.
[46:38:16] Yeah that's fine.
[46:38:17] What the fuck is going on?
[46:38:19] Uh AJ
[46:38:20] I've been on this boss
[46:38:21] for a how long chat?
[46:38:22] Okay you are
[46:38:22] the mentally strongest
[46:38:23] person I know.
[46:38:24] I swear to God.
[46:38:25] Nah AJ
[46:38:26] I ain't gonna lie bro. I swear to God. I don't know anyone else who'd I know
[46:38:29] Anyone else would still be trying I swear to God
[46:38:33] Yo, are you having fun?
[46:38:35] I feel like it'll be fun when you finally beat the nigga, bro
[46:38:39] No
[46:38:42] 60
[46:38:46] Imagine that I flew to the opposite side of country.
[46:38:49] The nigga went on vacation and came back?
[46:38:51] Had a blast, came back this niggas still fighting not even
[46:38:53] the same DLC nigga the same boss bro
[46:38:56] Can you practice buffs than grace a couple times practice ain't no time for
[46:39:02] no fucking practice none of that yo bro you would have saved so much more
[46:39:06] time if you genuinely practiced why don't you practice because you don't need to
[46:39:13] you have a thousand deaths what do you mean you don't need to but you don't
[46:39:24] uh... the battle to help I have a mod of the year award.
[46:39:31] Oh, man he's definitely going to win.
[46:39:35] At the awards shows on God they should have a mod
[46:39:37] of the year award.
[46:39:38] I did it wrong.
[46:39:40] Wait go Grace. I might beat wrong. Wait, go Grace.
[46:39:42] Hold on, I might beat this shit in front of you. Hold on, watch this.
[46:39:44] Dagger out! L2
[46:39:46] dagger out.
[46:39:49] Dagger out.
[46:39:51] L2.
[46:39:53] L1
[46:39:57] Lady bad, L2
[46:40:01] L3 Flask.
[46:40:05] I'm not going to use it. so so so so so I'm not sure if this is the best way to do it, but I think it's a good idea.
[46:41:13] I don't know what to say about that one. It's just a very simple thing to do. I'm not sure if you can see the I Am I got greedy. Yeah, no, no, no.
[46:41:39] I'm missing though.
[46:41:41] It would do more if I hit my shots.
[46:41:43] I have a strength build now.
[46:41:45] But this is like...
[46:41:47] I've been breezing past phase one this whole time bro.
[46:41:50] So this isn't even impressive anymore it's like alright nigga.
[46:41:53] It's literally like okay nigga.
[46:41:55] Is this guy talking about the millennia?
[46:41:58] Yes, yes, yes bro.
[46:42:00] Pre-Bandai Namco sends a statue at the office.
[46:42:03] Well they're watching bro. They're deadass watchers.
[46:42:06] You could have your worst enemies in your room.
[46:42:09] Dead ass bro this shit is fucking cooked. enemies in your room wait somebody told me that I didn't need mana my whole man
[46:42:19] is down on Oh, my bugging.
[46:42:24] I don't need it huh?
[46:42:26] Oh, I don't okay.
[46:42:28] You said what?
[46:42:36] I don't know what the fuck I said. like what
[46:42:43] 10 minutes on this one. 10 bands if I get it on this one?
[46:42:51] 10 bands! Oh, fuck my flask. I'm not sure if this is the best way to do it, but I think you can just go with what's in your inventory.
[46:43:21] I don't know why they're doing that here... so so so so What the fuck is that?
[46:44:13] Oh my gosh bro.
[46:44:16] How do you dodge that?
[46:44:18] I don't know bro. How do you dodge that? How do you dodge that?
[46:44:19] Agent, I can't tell.
[46:44:21] I don't know bro.
[46:44:23] I literally have it and just spam.
[46:44:25] You get spammed attacks.
[46:44:27] I thought I was locked. Once I the dagger. Once I saw the dagger, I said yeah, it's over. I think you figured out this weapon though.
[46:44:30] Yeah, I did, I did.
[46:44:31] That was three hits to him on the first stage.
[46:44:33] 100%, 100% that was really good.
[46:44:35] That was really good.
[46:44:36] Ah!
[46:44:37] That was a really good shot.
[46:44:39] Hey lock in. I didn't lock it.
[46:44:41] I don't know.
[46:44:43] Wish me luck bro.
[46:45:15] Oh no! I'm just an idiot now. I'm not gonna lie!
[46:45:17] I'm not gonna lie, I'm just an idiot now.
[46:45:19] I'm a idiot, I'm a idiot, I'm a idiot,
[46:45:21] I'm selling bad.
[46:45:22] It's dodges literally.
[46:45:23] It's dodging and being greedy.
[46:45:25] It just dodged in me and greedy bro.
[46:45:27] I'm selling so bad bro.
[46:45:28] I'm selling so bad right now.
[46:45:30] I'm selling so bad bro.
[46:45:31] I'm selling so bad bro. I'm selling so bad, bro. I'm selling so bad, bro. I'm selling so fucking bad, bro.
[46:45:33] I'm selling so bad, bro. so I'm not sure if you can see the so so so so so so so so I'm not sure if you can see the so Oh my gosh, this is so hard bro It's so hard bro
[46:48:03] come on
[46:48:07] more patience
[46:48:09] more patience bro, more patience
[46:48:14] More Patience More patience. More patience.
[46:48:18] More patience, bro! Tsk so I'm not sure if this is the right way to do it, but I'll try.
[46:48:41] I think that's a good idea. so so I'm not sure if this is the best way to do it, but I think you can get a lot of damage out of that.
[46:49:13] I don't know what's going on here... so so I'm not sure if this is the best way to end it, but I think that's a good idea.
[46:49:45] I don't know what to say about this one... so so so I'm going to have to do this again. Did he just spam that? Did he just spam that?!
[46:50:39] Oh my gosh bro.
[46:50:43] Oh my gosh, bro. Oh my gosh!
[46:50:47] No they don't, no they don't.
[46:50:49] I tested that and they don't.
[46:50:54] You can't do that bro so so I'm not sure if you can see the so so I need to roll light. I need to go late
[46:52:10] I'm telling you I'm telling y'all that relate. I'm telling you I gotta be late
[46:52:14] I don't like I got it all like I have some more lights
[46:52:17] I ain't got it saying how to give so I gotta go i have to go like saying that it's ain't got to give
[46:52:18] something gotta go so i gotta go i'm telling you
[46:52:22] i'm telling you i'm telling you yes i do i know me
[46:52:25] i'm telling you bro so I gotta go Wow my book what buses watches
[46:52:38] I'm still heavy
[46:52:49] Wait why am I still heavy? Oh my gosh!
[46:53:07] I mean why am i medium? Why am i medium?
[46:53:11] Is it because of my weapon? Oh my god so regardless i can't even do nothing
[46:53:17] oh so Oh, somebody said dragon armor. so I'm gonna go back to the well I've been bottom it
[46:54:21] I can't be heavy oh still medium okay bad
[46:54:30] still medium
[46:54:34] still medium million pray for me chat pray for me uh so so so so so so so so so I promise you, a thousand year voyage guided by compassion. so so so so so so so I'm going to have to do a little more of this. I can't get a hit.
[46:58:45] I can't get a hit.
[46:58:48] And them hits are, like, long as fuck.
[47:01:19] Fuck, come on so Hey, what the fuck? so so so so so so I'm not sure if you can see the so so so I gotta walk, I gotta walk up! I gotta walk up to this Stay close, Spat. Come on, come on, come on chat, come on!
[47:02:00] Come on! so so That was just unlucky right?
[47:02:30] That has to just been unlucky.
[47:02:38] That was just unlucky.
[47:03:11] That run was just unlucky bro, there's no way. Come on, bro. so I'm not sure if this is the best way to do it, but I think that's what we're looking for.
[47:04:09] I don't know why they didn't use a bomb here......but I guess you could say that was a mistake. so so so so I fucking hate this game, chat.
[47:04:11] I'm trying to keep my composure right now but I'm about to throw my shit out the window.
[47:04:14] I'm about to throw my shit out the window. I might have thrown my shit out the window right now.
[47:04:22] Sigh Thank you for watching! so I'm not sure if this is the best way to do it, but I think that's a good idea.
[47:04:52] I don't know what to say about this one... so so so so I'm ready. Ready? Pretty. Pretty good.
[47:05:52] I wasn't even too intimate. so so so I'm not sure what the game is doing here.
[47:06:39] I don't know if it's just me or the game itself, but I think this is a good way to end the video. so so so so I'm not sure if this is the best way to do it, but I think that's a good idea.
[47:07:32] I don't know what to say about this one... so so so I'm not going to let you get away with this. You're a fucking idiot!
[47:08:20] Are you kidding me? You can't even, you can't be patient. You can't be patient right there Chad.
[47:08:22] Like you just gotta get the heel off bro!
[47:11:21] I'm not gonna let you go. Gotta get the heal off, bro! uh so so so so so so so I'm not sure if you can see the so so so Thank you for watching. The so What? What? My car!
[47:11:23] What?
[47:11:25] My car!
[47:11:27] My car!
[47:11:29] My car! My car! What? What?
[47:11:35] Like what do you do with certain purge bro?
[47:11:39] But that nigga is spamming Bro he's spamming bro so so I'm not sure if you can see the so so oh my god Oh my gosh.
[47:13:02] I wanna try a light roll chat I want to try my light roll bro
[47:13:16] let me just see.
[47:13:22] I'm still medium?!
[47:13:26] I'm still medium?
[47:13:29] I was missing the...I didn't even have a
[47:13:33] tailsman!
[47:13:37] ... Look
[47:13:46] Watch this
[47:13:47] I'm gonna show you something
[47:13:48] Okay, hold on just pay attention bro
[47:13:51] just look just look just look so so so so so The so so so See that is not it creates space it creates
[47:15:51] space that's why I like it, it creates space.
[47:15:58] I just feel slow.
[47:16:05] I'm dodging wrong yeah but
[47:16:06] it creates a little space bro look. so so so so That was risky, that was risky. That was risky, that was risky.
[47:17:13] That was risky.
[47:17:15] I hesitated!
[47:17:17] Oh when you see he was just go?
[47:17:21] He was just go?
[47:17:23] Does he get does it get staggered into the instance tag or what?
[47:17:34] Instance Instant stagger?
[47:17:42] If I didn't stagger in phase 1...... so so so so So I can't do it now.
[47:18:39] Don't rush him, don't rush him! Oh no! so so i have to so so so so so so so That was my best one!
[47:20:43] That was my best one! That was my best one.
[47:20:48] That was my best one, that was my best one
[47:20:52] Was that my best one? Yes or no?
[47:20:57] Alright hold on. Let's relax, let's relax.
[47:21:01] Oh shit... Let's relax.
[47:21:10] R2 dodge into R2 again.
[47:21:13] Wait, what do you mean?
[47:21:14] R2 dodge into R2 again.
[47:21:15] What do you mean?
[47:21:16] What do you mean? At dodge into R2 again?
[47:21:17] What do you mean?
[47:21:17] What do you mean?
[47:21:18] What do you mean?
[47:21:18] What do you mean?
[47:21:20] At start R2.
[47:21:23] At star of what?
[47:21:24] Phase one or phase two? Phase two. R2, Dodge, Insta-R2.
[47:21:34] Whatever the attack is.
[47:21:41] Yup!
[47:21:45] Who dat?
[47:21:48] My boy A!
[47:21:52] Come on bro Let me sit down real quick
[47:21:54] I need to say something to you
[47:21:56] How do we need to sit down?
[47:21:58] Talk your shit, matter of fact sit sit down on the throne bro! The throne?
[47:21:59] Yeah yeah.
[47:22:00] Well I'll beat you to it.
[47:22:01] I can never do the throne.
[47:22:02] That's yours game.
[47:22:03] Okay okay okay.
[47:22:04] That's yours and I wanna say it...
[47:22:05] It's yours.
[47:22:07] And I want to try to-
[47:22:08] How do I do-
[47:22:09] I want to try to give you, first of all this is fire.
[47:22:11] Yeah, I don't even know where am I?
[47:22:13] I'm still listening right now but...
[47:22:15] Is it worth not seeing it?
[47:22:16] Yeah!
[47:22:17] This is crazy.
[47:22:18] Oh shit.
[47:22:24] Secondly though, I've seen that you've been live for 96 hours.
[47:22:33] And, you know, I don't know how much of that is this last guy. 60.
[47:22:35] Okay.
[47:22:37] More like 40-42, 43?
[47:22:41] 40-42, okay so you're definitely probably over what do we say half your time doing this?
[47:22:46] Yes way yes right chat yes!
[47:22:49] Is that yes chat?
[47:22:50] Yes
[47:22:52] Oh they are saying 60 Yes Yes. Cap, oh they're all the same 60?
[47:22:54] Yes.
[47:22:55] Okay alright.
[47:22:56] Okay well listen I sometimes be gaming and sometimes be playing with my friend upstairs
[47:23:01] Agent 00.
[47:23:03] And every time he do a tournament
[47:23:05] he have me call him and give him a little motivation all right talk to me
[47:23:08] bro so i'm here courtesy of my friends
[47:23:11] upstairs to give you just a little bit more motivation.
[47:23:14] I don't know if we need some inspiring music or something?
[47:23:18] You know what I'm saying, maybe give me like a little...
[47:23:24] I got you.
[47:23:25] I got you right now.
[47:23:26] Oh, you do?
[47:23:27] Okay.
[47:23:28] Yeah.
[47:23:29] And I'll give you a little recommendation today.
[47:23:32] What?
[47:23:33] This is Inspirite.
[47:23:35] Is that...? for inspiring music?
[47:23:36] Yeah!
[47:23:38] Look, no hold on. Bro this is not inspiring music.
[47:23:40] Yes it is! It's a build up!
[47:23:42] No no no, listen motherfucker where were you when you were with Dr Disrespect at a party at TwitchCon?
[47:23:47] We saw you! See?! You see how that fit, chat?!
[47:23:51] Turn this off. Turn this off.
[47:23:55] It fit a little too well. So listen, what we're gonna do is
[47:23:58] you have like a YouTube or something? Just type in
[47:24:02] Sleeping at Last Indian. Sleeping at last?
[47:24:06] Yeah yeah, sleeping at la... I think that's it.
[47:24:11] Sleeping at last.
[47:24:17] Yeah, yeah, yeah, yeah. Talk to me over here.
[47:24:21] Listen!
[47:24:25] I'm here today
[47:24:31] because i'm here today because i need y'all in the chat to know something and i have to remind this man.
[47:24:45] This guy in front of you!
[47:24:49] Death This guy in front of you!
[47:24:53] Death, hours minutes, seconds
[47:24:55] He took it all to be
[47:24:59] He took it off!
[47:25:01] Cut, cut, cut.
[47:25:04] I didn't know he was like that.
[47:25:06] I didn't know if I hit him or just gonna do it.
[47:25:09] Take two. Here we go, Aimee.
[47:25:11] From the top, from the top. I'm just gonna do it. Yeah, yeah. Take two.
[47:25:12] Here we go, Aimee.
[47:25:13] On the top!
[47:25:14] On the top!
[47:25:15] You there...
[47:25:16] Watching this young man play games.
[47:25:23] You don't know, but I do.
[47:25:27] He was chosen as a young boy.
[47:25:30] I first saw him in Greece, where he was saving a child.
[47:25:37] I then saw him in New York City
[47:25:40] Where he tried to learn the quality and sound of a whisper.
[47:25:46] I thought it was done there, but then I saw him save
[47:25:50] a helpless woman out in the streets of Boston!
[47:25:55] And he reunited her with
[47:25:57] her family.
[47:25:59] All those things
[47:26:02] pale in comparison to beating a
[47:26:04] video game that you have already set for yourself
[47:26:07] a high standard.
[47:26:08] That YOU
[47:26:09] HAVE ALREADY DONE!
[47:26:11] So I'm tired of this bullshitter
[47:26:13] the 96 hours?
[47:26:14] 100 HOURS?
[47:26:15] I DON'T NEED IT! Because it stops me 96 hours, 100 hours. I don't need it!
[47:26:17] Because it stops right here! It ends right
[47:26:21] here! Because if you are not the best health and green gamer
[47:26:25] out there, Who is?!
[47:26:26] Ludwig, fuck that!
[47:26:28] You are!
[47:26:29] And you're gonna show it right now
[47:26:31] because it doesn't matter about hour one.
[47:26:34] It doesn't matter about hour three.
[47:26:36] It doesn't matter about hour three. It doesn't matter about hour 30.
[47:26:38] It matters about the hour that you finish, and you are finishing this hour.
[47:26:44] Do you feel me?
[47:26:45] I don't think you feel me! I don't think you understand!
[47:26:49] You're about to beat this game right now, there's no ifs ands or buts about it because
[47:26:54] who are you?
[47:26:55] Who ARE you?
[47:26:56] And what are you made of?
[47:26:58] Um... um...
[47:27:00] Dignity and dedication.
[47:27:02] Okay then show me!
[47:27:05] Show me what you're made of right fucking now gang!
[47:27:08] Turn this bullshit off.
[47:27:10] Start the game.
[47:27:12] I'm gonna show you right now.
[47:27:16] Come on!!!
[47:27:18] My room don't look like this for nothing bro! Come on! My room don't look like it's for nothing, bro!
[47:27:20] I'm the fucking outing room.
[47:27:22] For 96 hours for nothing?
[47:27:24] No!
[47:27:25] Hey...
[47:27:27] No.
[47:27:28] Hey...
[47:27:29] Hey... Look right here.
[47:27:32] What's right there?
[47:27:34] Ben!
[47:27:35] You didn't beat her for nothing gang.
[47:27:38] Right.
[47:27:40] You didn't put all those hours in, you didn't stream that week and a half tight shit straight
[47:27:45] you didn't do all of that for nothing!
[47:27:47] Now your right bro.
[47:27:48] Lock it!
[47:27:49] No build changes no nothing nothing. Right here!
[47:27:52] The shit that you just got or almost got done right there,
[47:27:54] You almost kinda did something like that!
[47:27:56] Let's go into it.
[47:27:59] I need Ws, I need height because this is the run!
[47:28:02] This is the run. Say it! This is the run.
[47:28:03] This is the fucking run!
[47:28:04] Manifest it right here!
[47:28:06] It's the run, this is the run.
[47:28:08] Come on!
[47:28:10] After everything we done been through.
[47:28:12] Okay let's go come on now
[47:28:16] i just i believe that's the come on bro come on Come on, bro. Come on.
[47:28:25] Come on, bro.
[47:28:31] Come on.
[47:28:33] Fucking come on, bro!
[47:28:41] I like that.
[47:28:47] Yes. I like that. Yes!
[47:28:53] Let him know you're there Hi! This is it!
[47:29:15] Let's go, baby. Leave!
[47:29:18] Yeah? Fuck him up!
[47:29:24] I like that one.
[47:29:27] Yes! Yes!
[47:29:32] He's cooking. He's cooking!
[47:29:44] He's cooking! Hey! Oh shit, all right.
[47:30:19] Come on, get out of my way now. I don't see a player see Yes! Here we go!
[47:30:33] Okay, it's cool. It's fine.
[47:30:39] That was good. Let me say this before I go.
[47:30:42] Yes?
[47:30:44] We need to maybe...
[47:30:46] Have we studied film?
[47:30:48] No, I know everything already!
[47:30:50] It's just about my dodge- it's just dodging, bro. That's it.
[47:30:53] I know all his moves are...
[47:30:54] Is that true chat?
[47:30:55] It really is just about his dodging?
[47:30:56] Bro, my timing is so off.
[47:31:00] Phase two without stagger instant run up in R2.
[47:31:03] Yeah, they just told me that too.
[47:31:05] Okay alright well hey listen
[47:31:07] I love you, I believe
[47:31:09] in you can do this, I feel something big
[47:31:11] coming within the next hour, I don't know
[47:31:13] why but i feel that. right and it's gonna happen
[47:31:15] alright so yes I'm a go upstairs fucking kill it do your thing
[47:31:19] go crazy when you get done me and the AP boys are coming down here to celebrate
[47:31:23] brother because its happening within the hour you feel me right Yeah I know, no stagger in first phase. so so so so so so so so so What I do wrong?
[47:33:34] What'd I do wrong, what'd I do wrong?
[47:33:36] I fucked up that first R2 right?
[47:33:40] Fuck! I fucked up that first R2.
[47:33:42] Fuck.
[47:33:43] That's an automatic stagger come on okay so so I'm not sure if this is the best way to do it, but I think you can just go with what's in your hand.
[47:34:23] I don't know why they're doing that here... so so so so so It works, and it works, and it works, and it works! It worked! It worked! It worked!
[47:35:31] It worked!
[47:35:33] It worked! so Bubble for phase two.
[47:36:00] I can't drink it fast enough then go to him. oh with the charge attack. so so so so Again.
[47:37:21] Again, again, again, I got 13 Flags going into Phase 2 and I keep dying y'all! so so I'm not sure if this is the right way to do it, but I think that's a good idea.
[47:38:07] I don't know what you're talking about, but I'll try to get out of here before they shoot me. so so so so I'm not sure if you can see the That's so cat. so
[47:39:20] promises are quickly so
[47:39:34] like what the fuck? so I'm gonna sure if this is the best way to do it, but I think that's a good idea.
[47:40:15] I don't know what you're talking about, but I'll try my best to get through this one. I hope so! so so so so I'm not sure if you can see the Oh, fuck!
[47:41:16] Okay, okay, okay, okay.
[47:41:20] Ah, fuck, okay.
[47:41:21] All right, we gotta go the wrong route.
[47:41:22] Long route long route long route long route
[47:41:26] I did hold the whole thing
[47:41:28] Wait the whole R1?
[47:41:31] I did
[47:41:39] okay do y'all like the instant R2?
[47:41:45] Do y'all like
[47:41:45] The instant R2
[47:41:46] And then
[47:41:50] Hit hour one
[47:41:51] And then the instant R2 again
[47:41:52] For bleed
[47:41:53] Okay Insta R2 again for bleed.
[47:41:58] I know,
[47:41:58] I know there's a new bot.
[47:41:59] Hold on.
[47:42:02] 47-55 from army. Okay. so so so Oh shit!
[47:42:59] It's a big shithana!
[47:43:07] ... so so so so I'm not sure if you can see the Bad combos, bro!
[47:44:25] Bad combos
[47:44:29] Use armor? Bro I'm... No. Like you just
[47:44:33] You see me adjust, bro you'll see me play better without the armor bro so I'm not sure if you can see the so so uh Oh my god, how did I do that? so so oh OOOOOOOWWW! The first so And I think it's worth it.
[47:47:06] I think it's lowkey, oh my god!
[47:47:08] I'm so happy that we got this one.
[47:47:10] We're gonna get the first one.
[47:47:12] I don't know what to say about this one.
[47:47:14] I just wanna say thank you guys for being here But I think it's worth it.
[47:47:17] I think is Oki worth the risk?
[47:47:23] I just gotta like get there faster
[47:47:25] And then like, get the fuck up out of there.
[47:47:30] That's your worst kit.
[47:47:32] I said worst kit.
[47:47:33] That's your worst fit. That shit worth it. Oh, so so so so so so so I'm not sure if this is the best way to do it, but I think it's a good idea.
[47:49:08] I don't know what to say about that one. It's just a very simple thing to do. Oh, fuck!
[47:49:20] Oh, fuck. Fuck!
[47:49:25] Fuck. Alright, one more try? Hold on wait...
[47:49:27] Hold on hold on hold on
[47:49:31] Hold on.
[47:49:36] Hold on, chat. Hold on.
[47:50:01] Hold on, hold on. I don't know. Alright chat look Hold on chat
[47:50:03] In case we beat it
[47:50:05] We gotta restart VOD in case you fucking beat it
[47:50:08] So that so that's not so now
[47:50:10] We can celebrate cuz we don't want to beat the fucking vod and then that shit cut off cuz we got a celebrate, bro
[47:50:15] hold on And then that shit cut off. Because we got to celebrate, bro.
[47:50:17] Hold on, hold on.
[47:50:19] Hold on.
[47:50:23] Wait, wait, wait.
[47:50:23] Hold on.
[47:50:27] Imagine I beat it and y'all can't even see my reaction. Imagine if I beat it, then my reaction goes-
[47:50:29] And then it cuts off right there
[47:50:31] Oh imagine if it cuts off
[47:50:33] Yo!
[47:50:34] Imagine if it cuts off when he's at like 2% and I go for a swing.
[47:50:39] He going first wing and it gets cut
[47:50:46] your that will be fucking insane.
[47:50:49] Look, chat, look.
[47:50:51] Ugh.
[47:50:52] Look, stay...
[47:50:53] Everybody stay in here?
[47:50:55] I'm gonna make a new vibe.
[47:50:56] But look,
[47:50:57] here's the thing, y'all.
[47:50:57] Here's the thing.
[47:50:59] This is what I need you all to you to do okay tell the whole world that like go everybody retweet them crazy okay hold on Hold on
[47:51:10] Hold on chat
[47:51:12] Everybody retweet this motherfucker
[47:51:14] Yo get the link
[47:51:16] Spam the link
[47:51:16] Hold on ready
[47:51:17] Everybody go to my page
[47:51:18] Constanat
[47:51:19] Go to my page Spread the word bro this is gonna be
[47:51:22] legendary bro second notification by the way.
[47:51:41] But do not make fun of how this is two days ago, please!
[47:51:45] Alright? Don't make fun of how this was two days ago.
[47:51:48] Alright? Let me rock!
[47:51:50] When I tweet this motherfucker out, you retweet it
[47:51:53] and be like oh shit act like
[47:51:55] act like you don't know bro. Okay?
[47:51:57] Fuck
[47:52:03] Right now.
[47:52:03] Pull up.
[47:52:06] Alright, Chad.
[47:52:07] Hold on.
[47:52:07] Alright.
[47:52:08] Alright.
[47:52:09] Shit.
[47:52:11] Do I tweet it out first?
[47:52:12] Or do I... Do I tweet it out first, or do I restart it first?
[47:52:28] Tweet it out. What did I do the last time? Not the last time with this one, my old...my old one.
[47:52:31] I think I tweeted it out first maybe
[47:52:48] okay i'm gonna try to eat first hold on all right boom boom alright I'm going to post this right here
[47:52:54] I'll post this right here.
[47:52:56] Alright, y'all.
[47:52:57] Everybody go...
[47:53:00] Right here. Hold on.
[47:53:03] Everybody retweet this.
[47:53:05] Everybody retweet this. Everybody retweet this.
[47:53:14] Retweet it right there, okay?
[47:53:16] Chat, everybody stay.
[47:53:16] Everybody stay. Everybody stay, everybody stay.
[47:53:17] Everybody stay, everybody stay, everybody stay
[47:53:21] Everybody stay, everybody stay
[47:53:25] Stay, stay, stay. Restore the stream
[47:53:30] 3...2...1...
[47:53:50] Hold on, hold on, hold on.. Hold on. Everybody stay
[47:53:54] Yo, yo here
[47:53:56] Go to the status
[47:54:01] Go to that status!
[47:54:02] Good on that status!
[47:54:03] Good on that status!
[47:54:05] Okay?
[47:54:06] And then look...
[47:54:07] Oh body beating out of the ring DLC...
[47:54:10] Boom boom boom boom boom, boom, boom, boom, boom.
[47:54:11] Three. I'm ending.
[47:54:13] Hold on. Three, two, one.